KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0266Help
Entry
LMOSLCC2372_0266  CDS       T02220                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmx01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmx00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287807..288946
Genome map
AA seq 379 aa AA seqDB search
MDQQKKIQILKDMINIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
NEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEYGVNAIDNLILFYNEIEKYVASIHATNEILGDFIHNVTVINGGNQV
NSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHVKLELLFDYDKQPVFSDRNS
SLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
GNYLEMVDVYKRIAIEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaaaaaaagattcaaattttaaaggacatgataaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtacaatacgacgtagacagagccagcctagtaagcgaaattggttccagt
aacgagaaggttttggcattttcagggcatatggatgtagttgatgcgggtgatgtatct
aagtggaagttcccaccttttgaagcgacagagcatgaagggaaactatacggacgcggc
gcaacggatatgaagtcaggtctagcggcgatggttattgcaatgattgaacttcatgaa
gaaaaacaaaaactaaacggcaagatcagattattagcaacagttggggaagaaatcggt
gaacttggagcagaacaactaacacaaaaaggttacgcagatgatttagatggtttaatc
atcggcgaaccgagcggacacagaatcgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccagagtatggtgtgaatgcaatt
gataatttgatactattttataatgaaatagaaaaatacgttgcttccatccatgccaca
aatgaaatacttggcgattttattcataatgtcacggtgattaatggcggaaatcaagtc
aatagtattccggaaaaagcagaactacaaggtaatattcgttccataccagaagttgat
aacgagactttgaagcgacgtattgttgaaattgtgaatgagttaaataaaaaagaacat
gtgaagttagagttactgttcgattatgataaacagcctgtatttagcgataggaattca
agcttagtgaatgtcgcacgtgatgttgcgaaaggtattattaaagaagagataccctta
cttggaatttctggaacaacagatgcagctgaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
ggaaattatttggagatggtagatgtttacaaacggattgccatcgagtttttatcttga

DBGET integrated database retrieval system