KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0347Help
Entry
LMOSLCC2372_0347  CDS       T02220                                 

Gene name
tpiA-1
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
lmx00010  Glycolysis / Gluconeogenesis
lmx00051  Fructose and mannose metabolism
lmx00562  Inositol phosphate metabolism
lmx01100  Metabolic pathways
lmx01110  Biosynthesis of secondary metabolites
lmx01120  Microbial metabolism in diverse environments
lmx01130  Biosynthesis of antibiotics
lmx01200  Carbon metabolism
lmx01230  Biosynthesis of amino acids
Module
lmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmx_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2372_0347 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOSLCC2372_0347 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOSLCC2372_0347 (tpiA-1)
Enzymes [BR:lmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC2372_0347 (tpiA-1)
Exosome [BR:lmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC2372_0347 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOSLCC2372_0347 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOSLCC2372_0347 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY53682
Position
complement(373779..374543)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLSANYVEIGHAERKNLFHEKTSEIAKKIQLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgactgccaaccttttagcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatcaatcattgatttaagcgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatccaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaaacaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acagactacatcgaaagcgctcatcaggctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system