KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0576Help
Entry
LMOSLCC2372_0576  CDS       T02220                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmx01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lmx00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(602838..604121)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTINELLNEVKAENNTNNSLQVESEVKSIIEKVKKDGDQALFDFTSQFDGVRLTE
LRVQTADIQSASSKVDPAFLVALQQAKANIESFHSKQKQHAFLDSEKDGVIRGQLIRPLE
TVGIYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPAENGINPHVLAAAQLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIASDLLSQAEHDILARAILITTSKKIAEETQNEINKQLENLPRKAIAQKSIETQ
GKIIIAANTQEMFDIMNEIAPEHLEVQLENPMNYLNQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacaataaacgagctattaaacgaagtcaaagcagaaaacaat
accaataattcactccaagtcgaatccgaagtaaaatcgattatcgaaaaagtaaaaaaa
gatggcgaccaagccctgtttgacttcacatcccagtttgacggcgtacggctcaccgaa
ctacgcgtccagaccgctgatatccaaagtgcaagttccaaagtcgaccctgcctttcta
gtcgcactccaacaagcaaaagcaaatatcgaaagtttccacagcaagcaaaaacaacat
gcttttcttgatagcgaaaaagatggcgtcattcgcggtcaattaattcgtccactagaa
accgtcggcatatacgttcccggtggcacggcagcctatccatcatcggtattaatgaat
gtgttgcctgccaaaattgctggagtaaagcgaatcgtaatgatcacccctcctgccgaa
aacggtattaatcctcacgttttagccgcggctcaactagctggtgtggacgaaatttac
caagttggtggtgcgcatggaatcgcagctcttgctcacggaacagaatccatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtgttt
ggcttagttgatatcgacatgatagctggtccatccgaaatcgtcgtgctcgcagatgaa
aatgccaatcccgctttcattgcttccgacttactctcccaagcagagcatgatatttta
gctcgtgctatcttaatcactactagtaaaaaaatcgccgaggaaactcagaacgaaatt
aataaacagctagaaaatttacctcgaaaagcgattgctcagaaatccatcgaaacacaa
gggaaaatcattatcgcagcaaatacgcaagaaatgtttgatattatgaacgaaatcgct
cctgaacacttagaagtacaacttgaaaatccaatgaattacctcaatcaaattaaaaat
gccggttcgattttcttaggaagctatgcatcggaacctcttggcgactattttgccgga
ccaaatcacgtcttacctacaagtggtaccgcgaaattcttctctcctctcggcgtggaa
gatttcacgaaacgttctgcctttatttcttacacaaaagaagcactcgcaaaagaaaaa
gatgctattgttttacttgctaaaaaagaaggcctagatgcccatgccaaagccattcaa
attcgtttcgaggaggaaaactaa

DBGET integrated database retrieval system