KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0750Help
Entry
LMOSLCC2372_0750  CDS       T02220                                 

Definition
glycoside hydrolase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2372_0750
Enzymes [BR:lmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC2372_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
768363..769736
Genome map
AA seq 457 aa AA seqDB search
MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIADVRVIPDMPDESDFESFKTASDH
YHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEFYSNMLAELEKYNIEPV
VTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRVKYWVPFNEQNFISIDSE
YMSGYRAKNKAEVFQIQHHFNLCYAEATKLVHQIDPDAKVGGNIGNICPYPMTCKPEDVE
ASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFEQIILDDDLTIIKSSEPDFMSLTYY
MSSAIEAKGEEEVVVMNGIKAPNPYCETTEWGWTIDPYGFKHYLQEFYHRYQLPILILEN
GMGARDEKNTDDTIDDTYRIDYLASHIARMQEAVEEGCEIIGYLTWSATDLYSTREGFEK
RYGFVYVDKDNSYKRLKKKSFYWYKKVIETNGNDLNY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttgcaaaaaggttttccagaaaattttaaatggggtagctccactaatgcg
caacaatttgaaggtggctataaagaaggtggaaaagggctttcgattgcggatgtgagg
gttattccagatatgccagacgaatctgattttgaatcgttcaaaacggcttcagaccat
tatcatcattataaagaggatattgcttattacggggaaatgggcttccaaatttatcgt
tttacaatggcttggtcgagaattttcccgaacggagacgaaacagaaccaaacgatgct
ggagttgagttttatagtaatatgttggcagagttagaaaaatataatatcgaaccagtt
gttactttatatgcttatgatatgccgttacaactgcttgaaaaatataatggttggcta
gatagagcaattatcaaagattacctacattatgtagaaacggtcgtgaaattatttaaa
ggtcgagtgaaatattgggttcctttcaacgagcaaaactttatttcgattgattctgaa
tacatgagtggttatcgtgctaaaaataaagcagaagttttccaaattcaacatcatttt
aatttgtgttatgcagaagcaacgaagcttgtacaccaaattgatccagatgcaaaagtt
ggtggaaatattggtaacatttgcccttacccaatgacttgcaaacccgaagatgtcgaa
gcaagtgacaaagtagcgcaacagttaggttatgcttatggagatatttatttcagagga
tactatccaaaatacttccttaaagaatatgaaggcgtagattttgagcaaatcatttta
gatgatgacttaactattatcaaaagttctgagccagacttcatgtcgttaacatactat
atgtcgagtgcgattgaagcaaaaggtgaagaggaagttgtggtaatgaacgggatcaaa
gcgccaaacccatattgtgaaacaactgaatggggttggacaattgatccatatggtttt
aaacattatttgcaagagttctatcatcgctatcaattaccaattctaattctggagaat
gggatgggtgcacgcgacgaaaaaaataccgatgatacaattgatgatacgtaccgaatt
gattatttggcttcacatattgcgcgtatgcaagaagctgttgaagaggggtgcgaaatt
attggttatcttacatggtccgcaacagatctttattcaacgcgtgaaggtttcgagaaa
agatatggctttgtttatgttgataaagataatagctataaacgtttgaagaagaaaagt
ttctattggtataaaaaagtaattgaaactaatggaaatgatttaaattattaa

DBGET integrated database retrieval system