KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0896Help
Entry
LMOSLCC2372_0896  CDS       T02220                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmx00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
921901..923280
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQERDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATEIVKKNNAYEISFADGDKMEADGVIIAATHDALIHLLAETTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
TDYPGVFFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaactaggcggg
aaatttgaaacggttaaacgtgacgggtttttaattgaaaaaggtccagattccttctta
gctagaaaacctgctggtgtgggcttagtaaaagatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcttacatttaccaccaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagataaagaagcactgctagctagtacacttgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacga
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacagttaaaaaatatgggaatttgatggatggtttaaaa
gaaagtagcatgcaaacgacagggacaaaagccactattggtgcttttagaacattagaa
ggtgggctagatgctttgccaaaagctattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacagaaattgtgaagaaaaataacgcttacgaaatttcttttgca
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgttaatt
catttattagcagaaacaacgacagaaccattcgcgggacaaccgcttacgacccttgcg
accgtttcgttagcatataatgaacaagacgtaccgattttacctgatggaacaggctat
ctagttgccagaaccgcaccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccaaagaacaaaatgttactacgaggctttgttgggaaagcaggagaa
acttggttagagcaagcaagcgatgaagcaatcgtctcagctgttttgagagattatgcg
gaaattatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgcg
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
acagattacccaggtgttttttttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggggctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system