KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1096Help
Entry
LMOSLCC2372_1096  CDS       T02220                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LMOSLCC2372_1096 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOSLCC2372_1096 (rfbC)
Enzymes [BR:lmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LMOSLCC2372_1096 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115252..1115812
Genome map
AA seq 186 aa AA seqDB search
MEIVESKLAGVKLVKPKVFGDHRGFFMESYNEKAFHEAGIDMKFIQDNHSLSVEAGVLRG
MHYQTNPKAQTKLIRVATGAIYDVVVDMRKGSPTYGEWEGYILSEANKHQLLVPQGFAHG
FCTITENVNVLYKVDQLYSPENDAGIAYDDPDLNITWPTDKLILSDKDTKHPRLKDAENN
FVWENK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgaaagtaaactagctggtgttaaattagtaaaaccaaaagtgtttgga
gatcatcgtggttttttcatggaaagctataatgaaaaagcattccatgaagctggaatc
gatatgaagtttattcaagataaccactctctttctgtggaagcgggtgtacttcggggt
atgcattatcaaacgaacccaaaagcacagacaaaattaattcgtgttgcgacaggcgca
atttatgatgtagttgttgatatgcgtaaaggttctcctacatacggtgagtgggaaggt
tatattttaagcgaagcaaacaaacatcaacttctagtaccacaaggatttgctcatggc
ttttgtacgattaccgaaaatgtgaatgtgctttataaagtagatcaattatattcccct
gaaaacgatgcgggaattgcctacgatgatccggatttaaatattacttggccaacagat
aaattaattttatcggacaaggatacgaaacatccacgtttaaaagacgctgaaaataat
tttgtatgggagaataaataa

DBGET integrated database retrieval system