KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1571Help
Entry
LMOSLCC2372_1571  CDS       T02220                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1560362..1562758)
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFDDTTEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLINYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDVKGIGFQRADELGRKLGLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQSILVAQVEKLAEEQKIITENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQ
EIFNPNDTGRRKEVQFGDIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMVG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgccttatttgatgatacaacggaagaacttttcatgaag
ggcacgatgttgtctaccattttttacaatgccgaaaacctcttttctgtcgtacgaata
ttggtaaaagaaacaaatgcggattgggacgaaaaagatattatcgtaactggctttttc
ccagcactccacgaacaagaagtctacactttctacggaaaaatgcaggaacatgctaaa
tttggtcaacaattcaaagcagaccggtttcgtaaagaaatgccacaatcacgcgctggt
ttaattaattatctttctggagaactttttaaaggaattggtaaagtaaccgctgaaaat
attgtggatacgattggcgatgatgctattacgaaaattttatccgatccgagtttgtta
aacacggtacctaagttgccatccggtgcagcggaaagtttgcttgcttcccttagagaa
aatcagggattagagcatgtgatggtcggtttaaacgaatatggctttggcccgcaatta
tccatgaaaattttccaggcctataaacaaaatgctattgaagtgttagagaataatcct
tataaattgattgaggacgtaaaagggattggttttcagcgtgccgatgagcttggacgg
aaactcggtcttggcgggaatcatccagaacggcttcgcgcagggattttatttatgtta
gattcggtttgtatgcaacaaggtcacgtatacatggagcaagaggttctgcttggagaa
gtgacatatttgctagaagaaagtgaaggcattcgaattgaccaaagtattttagtagct
caagtagaaaaattggccgaggaacaaaagattattacggaaaacacacgcgtatacatg
ccatcgctctattattcagagagtggctttgcatatcatgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccacaatccgaatttttactagctctaggagaattagaa
gaaaggattggcgttcattacggagactcacaacgacaggctttagaacaagctttaatg
tctccgatgctcgtacttactggtggtcctggaacagggaaaacaacggtcattaaaggg
atagtggagctgtatgcggaactaaatggtgtgagtcttgatccccatgcttacaaagat
ggagcgactttccccgttcttcttgctgctccaactggtcgtgccgctaaacggatgtca
gagtcaactggacttcctgcgatgactattcaccgtctactcggaatgaatggtcaagaa
caaatggatgatgatgcagaaagactgattgatggacgactgttgattgtggatgagatg
tcgatggttgatatttggcttgctaatcaattattccgtgctttaccagcgcacatgcaa
gtggtactcgttggcgaccaagatcagttgccttcagtcggaccgggtcaagtactcaaa
gatattctgcaatctgaacaaattccaactgtagctctttcagatatttatcgccaaaag
gatggttcttccattatcgaaatggcgcattatataaaagaaggcatgttgccagctgat
ttcaccaaaaatagcgccgatcgctccttttttcattgcacggtaaatcaaattggtgat
gtggtcgaacaagtggtaaaaaatgcaaaaaacaaagggtttcgagcaaaagatatccaa
gttttagcaccaatgtatcgtggtcccgcaggcattgatattttaaataaaaaactacaa
gaaatcttcaatccaaatgatacagggcgtcgtaaagaagttcaattcggtgacataaag
tatcgcgtgcatgacaaagtactgcaattgattaatcaaccagagaaaaatgtgtttaac
ggtgatatcggtgaaattgtttctataatctacgccaaagaaaataccgaaaaacaagat
ctgattgtcgttcaatttgaccaaacagaggtttcttactataggcaagaatttaatcaa
ttgacccatgcttattgttgttcgattcataaagcgcagggaagtgaatttccgattgtg
attatgccgattgtccgcagttactaccggatgttgcgtcgcgatttactctacactgga
gtaacgcggagtaaacaatttctcattctttgcggggaagaagaagcttttcgaatgggg
atagaacgaattgatgaaaataagcgtaatacaacactctctgaacgtttaatgagcgaa
gatgttttattagaacaaatgacgaataaacgaattctcactgctgaaaacattacggaa
attgatccgatgattggaatggaagggattactccagaacagtttatggtaggataa

DBGET integrated database retrieval system