KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1595Help
Entry
LMOSLCC2372_1595  CDS       T02220                                 

Gene name
ruvA
Definition
holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1588803..1589408)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEADLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgttgag
gcaggacaaatcggctatcaaataattacagggaacccgttttcctttcaacgactagaa
ggtacagaagcgcaagtctttttgtatcagcatgtgagagaggataatatttctttattt
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcactagccattattgcttcaggcgatgtcgttccactaatttcagcg
attgaatccgaagacgatgtttatttaaccaaatttccgagtgtcggtaaaaaaacagct
cgccaaattattcttgatttaaaaggaaaactggctgatgttgttgcgagcgaaattgtt
tatgttgccccagaaaacgatatggttgcgggactttccccgcaattagaagaggccgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gctaaagaagctgacttaacaagcgacgcatatatcaagctagcgctacaattaatgaca
aaatag

DBGET integrated database retrieval system