KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1617Help
Entry
LMOSLCC2372_1617  CDS       T02220                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC2372_1617 (hemB)
Enzymes [BR:lmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LMOSLCC2372_1617 (hemB)
Exosome [BR:lmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC2372_1617 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610860..1611834)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVVSMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPKILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAKSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVIEMLT
SMKRAGATLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagtttctatgcctggggtttttcaatatcctttacatgaa
ttagaagaagaaatgcgcgtagttgaaagtcttggtattaaagcggttattttatttggc
attcctgccgaaaaagacgcagttggtacgcaagcttatcacgaccacggaattattcaa
gaagctacaagacttattaaaaaaagttttcctaaaattcttgtggtggctgacacttgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggtgaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgcagcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagctgggttttatgatatcccaattatgtcttatgctgttaaatatgcttctgctttt
tacggaccgttccgtgatgctgctggcagtgcacctcaatttggtgataggaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaaagtcggatgaacaagaa
ggcgcagattttcttattgtaaaaccatcattatcttacttagatatcatgcgcgacgtt
aagaataataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagacgaagaaaaaattgttatagaaatgctaacc
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgtatctaaa
tacttaaataaatag

DBGET integrated database retrieval system