KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1634Help
Entry
LMOSLCC2372_1634  CDS       T02220                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOSLCC2372_1634 (pfk)
   01230 Biosynthesis of amino acids
    LMOSLCC2372_1634 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2372_1634 (pfk)
   00030 Pentose phosphate pathway
    LMOSLCC2372_1634 (pfk)
   00051 Fructose and mannose metabolism
    LMOSLCC2372_1634 (pfk)
   00052 Galactose metabolism
    LMOSLCC2372_1634 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2372_1634 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMOSLCC2372_1634 (pfk)
Enzymes [BR:lmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMOSLCC2372_1634 (pfk)
Protein phosphatases and associated proteins [BR:lmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMOSLCC2372_1634 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1630589..1631548)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgcgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatt
ggtggagatggttcttaccacggagcggaagcacttacaaaacgtggattcccaaccatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaatactgttcttgatgcacttgataaaatccgcgatacagctacaagtcac
gaacgtactttcattattgaagttatgggtcgcgacgctggtgatatcgctctttggtct
ggtcttgctggtggcgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggcaaaaaacatagtattatcgtcgta
gctgaaggcgtaatgtctggtaatgaatttgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccgactgcatttgac
cgtgtacttgcaagtcgtcttggtgcacgttcagtagaattattgctagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgagattttg
aaagaaaaacacactcttgatcaaaaattatttgatcttgcatcaattttgtcgatttaa

DBGET integrated database retrieval system