KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_2589Help
Entry
LMOSLCC2372_2589  CDS       T02220                                 

Gene name
murA-1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lmx00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lmx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2621389..2622681)
Genome map
AA seq 430 aa AA seqDB search
MEKIIVRGGKQLNGSVKMEGAKNAVLPVIAATLLASKGTSVLKNVPNLSDVFTINEVLKY
LNADVSFVNDEVTVDATGEITSDAPFEYVRKMRASIVVMGPLLARTGSARVALPGGCAIG
SRPVDLHLKGFEAMGAVVKIENGYIEATAEKLVGAKVYLDFPSVGATQNIMMAATLAEGT
TVIENVAREPEIVDLANFLNQMGARVIGAGTEVIRIEGVKELTATEHSIIPDRIEAGTFM
IAAAITGGNVLIEDAVPEHISSLIAKLEEMGVQIIEEENGIRVIGPDKLKAVDVKTMPHP
GFPTDMQSQMMVIQMLSEGTSIMTETVFENRFMHVEEMRRMNADMKIEGHSVIISGPAKL
QGAEVAATDLRAAAALILAGLVADGYTQVTELKYLDRGYNNFHGKLQALGADVERVDDSK
VDVTNLASLF
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaattattgtacgcggtggaaaacagttaaatggttctgtgaaaatggaaggt
gccaaaaatgctgtattaccggtaatagctgctacattacttgcgagtaaaggtactagc
gtattaaaaaatgtcccaaacttgtctgatgtattcacaatcaatgaggttcttaaatat
ctaaatgcagatgtttcttttgtaaatgatgaagtaacagttgatgcgacaggagaaatt
acttctgatgcaccttttgagtacgttcgtaaaatgcgtgcttccattgttgtaatggga
ccacttttggcacgtactggttcagcgcgtgtagctttacctggtggatgtgcaattggt
tctagacctgttgatttacatttaaaaggctttgaagcaatgggcgcagtcgtgaaaatt
gaaaatggttatattgaagcaactgctgaaaaattagtaggtgctaaagtatacttagat
ttcccgagtgttggagcgacacaaaatattatgatggctgcgactcttgcagaaggtaca
acagtcattgaaaacgttgctcgtgaacctgaaattgttgacttggcaaacttccttaac
caaatgggtgctagagttatcggtgcaggaacagaagtaattagaattgaaggagttaag
gaattaactgcgactgaacattctattattccagaccgtattgaagcaggaacatttatg
attgctgcggcgattactggtggaaatgttttaattgaagatgcagttcctgaacatatt
agttcgttaattgctaaacttgaagaaatgggcgttcaaatcattgaagaagagaacggg
attcgtgtaattggccctgataaattaaaagctgtagatgttaaaacgatgccgcatcca
ggtttcccaacagatatgcaatcgcaaatgatggttattcaaatgctgagtgaaggcaca
agcatcatgactgaaactgtttttgagaatcgttttatgcatgtagaagaaatgcgcaga
atgaatgctgatatgaaaattgaaggacattctgttattatttctggtccagctaagtta
caaggagcagaagttgcagcgacagatttacgtgcagcagcagcgcttattcttgctggt
ttggttgcagatggctatacacaagtaactgagttgaaataccttgatcgaggctataat
aatttccacggaaaactacaagcgcttggtgctgatgtggaacgtgtagatgattccaaa
gtcgatgtaacaaacttagcgtctttattctaa

DBGET integrated database retrieval system