KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_2610Help
Entry
LMOSLCC2372_2610  CDS       T02220                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOSLCC2372_2610 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2372_2610 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOSLCC2372_2610 (thrC)
Enzymes [BR:lmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOSLCC2372_2610 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2639593..2640648)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWGLAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacgcca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
cttggggttactttatacggaaaatacgaaggcttaaatccaaccggttcttttaaagat
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tatggcgcagatattatctcgattcaaggtaatttcgatgaagcattaaaatcggttcgt
gaattagctgaaacagaagcagtaacacttgtaaattccgtgaatccatatcgtttagaa
ggtcaaaaaacagctgcattcgaaatctgtgagcaattaggttccgcgccagatgtactt
gcaattccagtcggtaatgccgggaatatttctgcatactggaaggggtttaaagaatgg
aatgaggctaaagcttctggactgccgcggatgcatggttttgaagcagaaggagctgcg
gcgattgttcaagggaaaccaattgataacccggaaacaattgcaacagcgattcgtatc
ggaaacccagctagttgggggcttgcagaagcagctcgcgatgaatctggcggatacatc
cattctgtaacagacgacgaaattgtgaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccgggttctgccgcttcattagctggtgtcattcaacatgtagcaaat
ggaacaattaaaaaaggggaaacagttgtttgtgtctttactggaaatggcttaaaagat
ccagatactgcgatgagtgtgcatgaaattccaatttcccatgtggatgatattgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system