KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_2920Help
Entry
LMOSLCC2372_2920  CDS       T02220                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMOSLCC2372_2920
Enzymes [BR:lmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMOSLCC2372_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2955672..2957372)
Genome map
AA seq 566 aa AA seqDB search
MTNLRKRLSRLYAEDVVDSLAARIEARVQQTQQRKLTRKDQWDEKDIVLITYGDQFKEES
QKTLTTFKKMYDSYLKSAFEIVHFLPFYPYSSDDGFSVIDYKAVNPELGDWKDIKEMEKS
ARLMFDFVCNHMSAKSDWFKRYLAGDEEFRNFFVEMDPNTDLSSVTRPRATPVLTTFQFD
SGKVGHIWTTFSEDQIDLNFACPEVLYKMIDVLMFYLEEGAEYVRLDAVGFMWKVPGTSS
IHLEETHEIVKLFRDLVDIAAPGTIIITETNVPHVDNISYFGNGEKEAHMVYQFPLPPLV
LHAIHHGNAKFLRNWAKNLELPEGKRTFFNFLASHDGIGLNPVRGIIPEAEILALVNDLE
EEGALVSYKQNPDGSKSPYEINVTYMDALSKQADTDDLRLARFLVAHAVLMSIPGVPAVY
VQSILGSRNDYLGVEATSHNRSINRKKYDLAEITAELEQRGSLRKATYDALTKLISTRKA
ESLFHPEIPMEVLESTAELFVVKRSSDAESIILIHNLSEKEVSYSLDSGVYTNLYKGSTV
TGSDSIKLSGYEFCWLKTKNYREEQK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaagaaaacgactttcgcggttatatgccgaagatgtggtagatagtttg
gcagctagaatcgaagcacgggtacagcaaacgcaacaacgaaagttaacgcgaaaagat
cagtgggacgagaaagatattgttttaattacatatggggaccaatttaaagaggaatcc
caaaaaacgttaacaacttttaaaaaaatgtatgatagttatttaaaatcggcttttgag
atagtgcatttcctacctttttatccttattcttcggatgatggattttcggtcattgat
tataaagcggtgaacccagagcttggtgattggaaagatattaaggaaatggaaaagtcg
gcgcgattgatgtttgattttgtttgtaatcatatgtcggcgaaaagtgattggtttaag
cgatatttagcgggtgatgaggaatttaggaacttttttgtggaaatggatccaaatacg
gaccttagttcggttacaagaccacgcgcgacaccagtactgacaacatttcaatttgat
tcaggaaaagtagggcatatttggacgacgtttagtgaggatcagattgatttgaacttt
gcttgtccggaagtgctttataagatgattgatgttttaatgttctatctagaagaagga
gcagaatatgtgcgacttgatgcggttggatttatgtggaaggtgccgggaacaagctcg
attcacttggaagagacgcatgaaatcgtgaaattatttagagatttagtagacattgca
gctccggggacgattattattaccgaaaccaatgtgccgcatgttgataatattagttat
tttggaaatggtgaaaaagaagcgcatatggtttatcaattcccgcttccaccacttgtg
ctccatgctatccatcatggtaatgcaaaattcctccgtaactgggcgaagaatttagag
ctaccagaaggcaagcggacattctttaatttccttgcctcacatgatgggattgggtta
aatccagtgcgcggaattattccagaagctgagattttggctttagtgaatgatttggag
gaagaaggtgcgctcgtttcttacaagcaaaatccagatggttctaagagtccttatgaa
ataaacgtgacgtacatggatgcgctaagtaaacaggcggacacagatgatttgcgactt
gcaagattccttgtggctcatgcagtattgatgtctatcccaggcgttccagccgtttat
gttcaaagtattttaggaagccgcaatgattatttaggcgtagaagcaacaagtcacaat
cgctctattaatcgaaaaaaatacgacttggcggaaattacagcagagttggaacaaaga
ggctccttacgaaaagcaacttatgatgcgctaacgaaattaattagcacacgaaaagcg
gaatcacttttccatccagaaataccgatggaagttttagaatctacggcggaattgttt
gttgttaaacgttcatccgacgcggaatcgattatattgattcataatttatcagaaaaa
gaagtgagttattcactagacagcggtgtttatacaaatctttataagggctccacagta
actgggagcgattccataaagcttagtggctatgaattctgctggctaaaaaccaaaaat
tacagggaggaacaaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system