KEGG   Listeria monocytogenes 08-5923: LM5923_0140Help
Entry
LM5923_0140       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lmy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmy00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lmy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lmy00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:lmy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(144934..146511)
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLRLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattactgacgagattgctaaa
tttagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaacaaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacttacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaatatcgcatccaccatgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaatcattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgatcattggctcgatattcacgaagacgatatcgtttgggccacagctggtccg
ggttggcaaaaatgggtttggtctccattcctttctgtacttggaaaaggcgcgactggc
ttcatttacaacggtcgctttattcctgaaaaacaacttcgtttactggaagaagaaaaa
atcaacgtgctatgctgtacgccaacagaatatcgtttaatggctaaagtaaataatttg
cgcgaacatgatttaagttcccttcgtagtgccgtatcagcaggagaacctttaaaccgc
gaagttattcaagttttccaagacaattttgatattaaagttcgcgacggctacggccaa
acggaaagtacgcttttgattgggacacttgttgatacgccgattcgtcctggttcgatg
ggtaaaccgattatgccagaatatatggctattattgatgcggacggaaatcccgttggt
gtcggtgaaattggtgacatcgcaatgcgtagagacttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattattttgtttctggtgac
cgagctatccgcgatgaagacaattactactggttccaagggcggaatgacgatattatc
attagctcgggttacacgattggaccgttcgaagtagaggacgcgcttacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagccctgacgaaatccgcggaacggtcgtaaaa
gcgtttatcgtcttaaaggatggttacgagggcaccgaggatcttgtgcatgaattacaa
acatttacgaaagaacaaactgctccgtataaatatccacgccggattgagtttgttgaa
gcgttaccgaaaactgattctggtaaaattcgccgcgttgagttgcgtgatgcggagttt
gctagtgtacacggataa

DBGET integrated database retrieval system