KEGG   Listeria monocytogenes 08-5923: LM5923_0278Help
Entry
LM5923_0278       CDS       T01164                                 

Gene name
gltX
Definition
hypothetical protein
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LM5923_0278 (gltX)
Enzymes [BR:lmy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LM5923_0278 (gltX)
Amino acid related enzymes [BR:lmy01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LM5923_0278 (gltX)
Transfer RNA biogenesis [BR:lmy03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LM5923_0278 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277622..279097
Genome map
AA seq 491 aa AA seqDB search
MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES
QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQELLDKDLAYKCYCTEEELDVE
REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE
SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI
FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGEEEIFSKE
EFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQA
ELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFKK
ELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREKV
LNRLDTWLKNN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaacaaaacgagtgcgtgtacgttatgcaccaagtccaactggatttttgcat
attgggaatgcacgtactgccttatttaactatttatttgcaagacataatgatggagat
tttatcattcgtattgaagacactgatgctaaacgtaacatagctgacggtgaagaaagt
caaatgacaaacttgaaatggcttggtatggactgggatgaaggtgttgatgttcctgga
aaatacggaccttaccgtcaatccgaacgtcaatcaatctatgagccgctaattcaagag
cttttggataaagatttggcatataaatgctattgtacagaagaagaattagatgtagaa
cgcgaaaaacaaaaagcaaatggtgaaatgcctcgttatagtgggaaatgtcgtcattta
acaaaagaacagcaagcggagaaagaagcgcaaggttttaaaccgagtattcgtttcaaa
gtgccggcaaatgaaacgattactttcaacgatatggtgaaagacgatgtttcgtttgaa
tcaaatggaataggcgattttgttattgcgaaaaaagacgggattccgacttataacttc
gctgtagcagtggatgaccatttaatggaaatctctcatgttcttcgtggggatgaccat
atttcgaatacgcctaaacaaattttgatttataatgcatttggctgggagccgccaatt
tttggtcatatgacacttattgtgaatgagagcagacgtaaattaagtaaacgtgatggt
tcgattattcaatttatcgaacaatatcgcgatttaggatatttaccggaagcattattt
aactttatcgctatgcttggttggtctccagaaggcgaagaagaaattttctctaaagaa
gaattcattaaaatgtttgatccgaagcgtttatctaagtcacccgcattattcgataat
gttaaattgacttgggtgaataaccaatatgtgaaaaaattaccgctaaatgatgtagta
gagctttctttacctcatttacaaaaagcgggtgttgtatctgctgagctaaatcaagct
gaacttgattgggtgcacaaattagtgtcactttatcatgagcaaatgagctatggtgcg
gaaattgtgccactttcagaaatgttctttgcggatgcagagtcaattacgtttgatgaa
gaagagacagcggtgttagcggaagagacagttccaactgttatttcggcattcaaaaaa
gaactagaagcactagaagttcttgaagctgcggaagtaaaagctgcaatcaagcgtgtc
caaaaagaaacgggcgtaaaaggtaaaggtttatttatgccaattcgtattgtgactact
ggtgaaatgcatggccctgaattgccacttgcaatcgaagttcttggtcgtgaaaaagtg
ctgaatcgtttggacacatggttgaaaaataattaa

DBGET integrated database retrieval system