KEGG   Listeria monocytogenes 08-5923: LM5923_0300Help
Entry
LM5923_0300       CDS       T01164                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296994..298436
Genome map
AA seq 480 aa AA seqDB search
MQIKNKAMLITYSDSLGKNMEELSKVMETCFEDAIGGIHLLPFFPSTGDRGFAPSDYTTV
DSDLGSWEMIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLNSKYKDMFIRINDFFPP
GRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQIDLDVTAEVTKEFIRQTIK
NMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKVEAAKYDMELLPEIHEHYS
IQMKIANHDYYIYDFALPMVMLYSLYSGRVERLAKWLEMSPMKQFTTLDTHDGIGVVDAR
DLLTDEELDYTSAELYKIGANVKKIYSSGKYNNLDIYQINSTYYSALGDDDKSYLLARVI
QCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTMDEIENEVKRPVVKALCNLL
RFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKIAATLKANLSTKTFQISENERNILI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattaaaaataaagctatgttaattacttattctgatagtttagggaaaaatatg
gaagaattatccaaggtgatggaaacttgctttgaagatgctattggtggaattcactta
ttgccgttctttccatccactggagatcgagggtttgcgccaagtgattacacaacagta
gatagcgacctaggctcttgggaaatgatcgagaaattaggcgaaaagtattatttaatg
tttgattttatgattaatcacatttctcgcgaatcactcttctttcaagattttaaaaaa
gagcatttaaactcaaagtataaagatatgtttattcgtatcaatgatttctttcctccg
ggcagaccaaatgaaaaagacttagatttaatttataagaggaaggataaggcgcctttt
caagaagttgaatttgccgatggggaaacggaattagtttggaatacttttggagaagaa
caaattgatttagatgtgacagccgaagttacaaaagaatttattcgtcaaacgataaaa
aatatggctgcacatggttgttctattttgcgtcttgatgcctttgcttatgcaattaaa
aaattagatacaaatgatttttttgtagaaccggaaatttgggatttactggatgaagtg
aaagtagaagcggccaaatatgatatggaattattaccagaaattcatgaacattattcc
atccaaatgaaaatcgcgaaccatgattattatatctatgattttgcgttacccatggtg
atgctttactcgttatatagtggccgagtggaacgtttagctaaatggttagaaatgagt
ccgatgaagcaatttactactttagatacgcatgatggcattggagttgtggatgcacgc
gatttattaacagatgaggaactcgattatacttcagcggaattatacaaaataggagct
aatgttaaaaagatatattcctctggaaaatataataatctggatatttatcaaattaac
agtacctattatagtgctttgggtgacgatgataaaagttatttgttggcgagagtaatt
caatgttttgcgccggggattccgcaaatttattatgttggtttacttgctggcaaaaat
gatattgaccttttagaagaaacaaaagaagggcgtaatattaatcgtcattactacaca
atggatgaaattgaaaatgaagtaaaaagaccagttgttaaagcgttgtgcaatttgctg
agatttagaaatacttctgaagcatttgatttggaaggaagtatagaaattgagacacct
agctcaaatgaaatagttattattcgcaaaaacaaaacaaataaaattgcagcgacatta
aaagcgaatttaagtactaaaactttccaaatcagcgaaaatgaaagaaatattttaatt
taa

DBGET integrated database retrieval system