KEGG   Listeria monocytogenes 08-5923: LM5923_0774Help
Entry
LM5923_0774       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_0774
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LM5923_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
773867..775240
Genome map
AA seq 457 aa AA seqDB search
MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIADVRVIPDMPDESDFESFKTASDH
YHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEFYSNMLAELEKYNIEPV
VTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRVKYWVPFNEQNFISIDSE
YMSGYRAKNKAEVFQIQHHFNLCYAEATKLVHQIDPDAKVGGNIGNICPYPMTCKPEDVE
ASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFEQIILDDDLTIIKSSEPDFMSLTYY
MSSAIEAKGEEEVVVMNGIKAPNPYCETTEWGWTIDPYGFKHYLQEFYHRYQLPILILEN
GMGARDEKNTDDTIDDTYRIDYLASHIARMQEAVEEGCEIIGYLTWSATDLYSTREGFEK
RYGFVYVDKDNSYKRLKKKSFYWYKKVIETNGNDLNY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttgcaaaaaggttttccagaaaattttaaatggggtagctccactaatgcg
caacaatttgaaggtggctataaagaaggtggaaaagggctttcgattgcggatgtgagg
gttattccagatatgccagacgaatctgattttgaatcgttcaaaacggcttcagaccat
tatcatcattataaagaggatattgcttattacggggaaatgggcttccaaatttatcgt
tttacaatggcttggtcgagaattttcccgaacggagacgaaacagaaccaaacgatgct
ggagttgagttttatagtaatatgttggcagagttagaaaaatataatatcgaaccagtt
gttactttatatgcttatgatatgccgttacaactgcttgaaaaatataatggttggcta
gatagagcaattatcaaagattacctacattatgtagaaacggtcgtgaaattatttaaa
ggtcgagtgaaatattgggttcctttcaacgagcaaaactttatttcgattgattctgaa
tacatgagtggttatcgtgctaaaaataaagcagaagttttccaaattcaacatcatttt
aatttgtgttatgcagaagcaacgaagcttgtacaccaaattgatccagatgcaaaagtt
ggtggaaatattggtaacatttgcccttacccaatgacttgcaaacccgaagatgtcgaa
gcaagtgacaaagtagcgcaacagttaggttatgcttatggagatatttatttcagagga
tactatccaaaatacttccttaaagaatatgaaggcgtagattttgagcaaatcatttta
gatgatgacttaactattatcaaaagttctgagccagacttcatgtcgttaacatactat
atgtcgagtgcgattgaagcaaaaggtgaagaggaagttgtggtaatgaacgggatcaaa
gcgccaaacccatattgtgaaacaactgaatggggttggacaattgatccatatggtttt
aaacattatttgcaagagttctatcatcgctatcaattaccaattctaattctggagaat
gggatgggtgcacgcgacgaaaaaaataccgatgatacaattgatgatacgtaccgaatt
gattatttggcttcacatattgcgcgtatgcaagaagctgttgaagaggggtgcgaaatt
attggttatcttacatggtccgcaacagatctttattcaacgcgtgaaggtttcgagaaa
agatatggctttgtttatgttgataaagataatagctataaacgtttgaagaagaaaagt
ttctattggtataaaaaagtaattgaaactaatggaaatgatttaaattattaa

DBGET integrated database retrieval system