KEGG   Listeria monocytogenes 08-5923: LM5923_0918Help
Entry
LM5923_0918       CDS       T01164                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM5923_0918
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LM5923_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925844..927223
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQERDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATEIVKKNNAYEISFADGDKMEADGVIIAATHDALIHLLAETTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
TDYPGVFFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacgaaaaactaggcggg
aaatttgaaacggttaaacgtgacgggtttttaattgaaaaaggtccagattccttctta
gctagaaaacctgctggtgtgggcttagtaaaagatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcttacatttaccaccaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagataaagaagcactgctagctagtacacttgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacga
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacagttaaaaaatatgggaatttgatggatggtttaaaa
gaaagtagcatgcaaacgacagggacaaaagccactattggtgcttttagaacattagaa
ggtgggctagatgctttgccaaaagctattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacagaaattgtgaagaaaaataacgcttacgaaatttcttttgca
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgttaatt
catttattagcagaaacaacgacagaaccattcgcgggacaaccgcttacgacccttgcg
accgtttcgttagcatataatgaacaagacgtaccgattttacctgatggaacaggctat
ctagttgccagaaccgcaccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccaaagaacaaaatgttactacgaggctttgttgggaaagcaggagaa
acttggttagagcaagcaagcgatgaagcaatcgtctcagctgttttgagagattatgcg
gaaattatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgcg
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
acagattacccaggtgttttttttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggggctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system