KEGG   Listeria monocytogenes 08-5923: LM5923_1227Help
Entry
LM5923_1227       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216295..1217776
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQEEIEQILVKEAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLENGRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVLDVVPTKTKEELSEVS
ELLFTSKEAVERFFDYLAQLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQENASNLIIGSIVDTAEVNAILAEVEAMEMMPLYDMRPVTERPFDLASFEQ
VCFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINHFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttatgttaattggtgcagggcctggggatgcgcaactactgacagtgaaa
ggtttagctgcactacaaaaggcagatgttattgtttacgatcgcctcgtcgaaccagcg
atgctccaagaacgaaaagctagttgtaaactaatttatgttggaaaagaaccacttcat
catccaattccacaagaggaaatcgagcaaattcttgttaaagaagctgcgacaaatgag
ctggttgttcgtctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaagga
gagacactctataaagcgggaattccatttgaagttattcctggaatcacatccgcaatt
ggtgggcttgcctacgctggaattccagtaacccatcgtgattttgcttcgagttttcac
gtgattaccggacatttgaaaaaaggacgtgatccactagattgggaagcccttgctaga
ctggaaggtacgctcgtttttctaatgggaatgactaatttacctaatatttgtgcgaac
ctactagaaaatggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgc
ggcaaacaattaacggttaccgggaacttacaaaacattgaacaaaaagtagcggaatct
ggtatttcttcgccggcacttattgtcgttggtgatgtggtgagcttacgaccacagctt
aacttctttgaggaaatgcctcttttccatacaaaagtattacttccaagagcacgagct
ggaaaaagtatgctcgcggaacaaattcgcgatttgggcggagaagtaactatgtatcca
aatattcaagtattagatgttgtgccaacgaaaacaaaagaagaactaagcgaagtaagc
gaacttcttttcacatccaaagaagcggtagaacgattttttgattatttagcccagctt
gatttagatattcgttctctaaaaaacacccatcttactgctattggcaagcaaacgaaa
gaagcttttagtgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttaattttggagcatttaccacggttacaggaaaatgcgagcaacttaattatcggaagc
atagttgatacggcggaagttaacgcaattttagcagaagtggaagcgatggaaatgatg
ccgttatatgatatgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaa
gtttgtttctcaagttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaa
aaagccattttacaaacgaaaacaattctttccattggaaggttcacgagcgcaacgtta
gcatcattcggtatcaaccattttatcgaagccgaaagcgccacaccagagagcttaatt
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system