KEGG   Listeria monocytogenes 08-5923: LM5923_1227Help
Entry
LM5923_1227       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LM5923_1227
Enzymes [BR:lmy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LM5923_1227
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LM5923_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216295..1217776
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQEEIEQILVKEAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLENGRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVLDVVPTKTKEELSEVS
ELLFTSKEAVERFFDYLAQLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQENASNLIIGSIVDTAEVNAILAEVEAMEMMPLYDMRPVTERPFDLASFEQ
VCFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINHFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttatgttaattggtgcagggcctggggatgcgcaactactgacagtgaaa
ggtttagctgcactacaaaaggcagatgttattgtttacgatcgcctcgtcgaaccagcg
atgctccaagaacgaaaagctagttgtaaactaatttatgttggaaaagaaccacttcat
catccaattccacaagaggaaatcgagcaaattcttgttaaagaagctgcgacaaatgag
ctggttgttcgtctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaagga
gagacactctataaagcgggaattccatttgaagttattcctggaatcacatccgcaatt
ggtgggcttgcctacgctggaattccagtaacccatcgtgattttgcttcgagttttcac
gtgattaccggacatttgaaaaaaggacgtgatccactagattgggaagcccttgctaga
ctggaaggtacgctcgtttttctaatgggaatgactaatttacctaatatttgtgcgaac
ctactagaaaatggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgc
ggcaaacaattaacggttaccgggaacttacaaaacattgaacaaaaagtagcggaatct
ggtatttcttcgccggcacttattgtcgttggtgatgtggtgagcttacgaccacagctt
aacttctttgaggaaatgcctcttttccatacaaaagtattacttccaagagcacgagct
ggaaaaagtatgctcgcggaacaaattcgcgatttgggcggagaagtaactatgtatcca
aatattcaagtattagatgttgtgccaacgaaaacaaaagaagaactaagcgaagtaagc
gaacttcttttcacatccaaagaagcggtagaacgattttttgattatttagcccagctt
gatttagatattcgttctctaaaaaacacccatcttactgctattggcaagcaaacgaaa
gaagcttttagtgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttaattttggagcatttaccacggttacaggaaaatgcgagcaacttaattatcggaagc
atagttgatacggcggaagttaacgcaattttagcagaagtggaagcgatggaaatgatg
ccgttatatgatatgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaa
gtttgtttctcaagttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaa
aaagccattttacaaacgaaaacaattctttccattggaaggttcacgagcgcaacgtta
gcatcattcggtatcaaccattttatcgaagccgaaagcgccacaccagagagcttaatt
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system