KEGG   Listeria monocytogenes 08-5923: LM5923_1351Help
Entry
LM5923_1351       CDS       T01164                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
lmy00330  Arginine and proline metabolism
lmy00332  Carbapenem biosynthesis
lmy01100  Metabolic pathways
lmy01130  Biosynthesis of antibiotics
lmy01230  Biosynthesis of amino acids
Module
lmy_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LM5923_1351 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LM5923_1351 (proB)
Enzymes [BR:lmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LM5923_1351 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ADB71193
Position
complement(1320385..1321215)
Genome map
AA seq 276 aa AA seqDB search
MRESLKNSKRLVIKVGTSTLMYGNGHINLRTIEKLAMVLSDLRNEGKEVILVSSGAIGVG
CHKLQLPVRPTSIPEQQAVASVGQSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPISREN
VMNTLESLLERGIIPIVNENDTVAVEELEHVTKYGDNDLLSAIVAKLVQADLLIMLSDID
GFYGSNPSTDPDAVMFSEINQITPEIEALAGGKGSKFGTGGMLTKLSAASYCMNANQKMI
LTNGKNPTIIFDIMQGEQIGTLFASKKEEFSHDGTH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatctttaaaaaatagtaagagactagttatcaaggttggtacaagtacatta
atgtatggaaatggccatattaacctaagaactatcgaaaaattagcgatggttttatcc
gatttacgtaatgaaggaaaagaagttatcttagtttcttctggggcaatcggcgttgga
tgtcataaattacaacttccagtgcgacctacaagtattcccgaacaacaagcagttgct
tctgtcggtcagagtgaattaatgcatatatatagtaagttttttggtgaatacggacaa
gttgttggtcaagtactacttactcgagatgtaactgacttccctattagtagagaaaat
gttatgaacacgctcgaaagtctcttagaacgcggaattattcctatcgtaaatgaaaat
gatacagttgctgttgaggaactagaacatgtaactaaatacggcgataacgaccttctt
tcagctattgtagctaaactcgtgcaagctgatttacttatcatgctatctgatattgat
ggcttttatggtagtaatccttcaactgacccagatgcagttatgttttctgaaatcaat
caaataacaccagaaattgaagcacttgctggcggtaaaggttctaaattcggaactggc
ggcatgttaacgaaactttccgctgcttcttattgtatgaatgctaaccaaaaaatgatt
ttaaccaatggcaaaaatcctacaattatttttgatataatgcaaggtgaacaaatcggg
actttatttgcaagtaaaaaggaggaattttcccatgacggaactcattaa

DBGET integrated database retrieval system