KEGG   Listeria monocytogenes 08-5923: LM5923_1409Help
Entry
LM5923_1409       CDS       T01164                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lmy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1378372..1379514
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKIILTASGGSFRDKT
REQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttcaattggaacacaaacgcttgcaatc
attcgcgaaaatcctgaaaaatttcaagttgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagagtttaaaccaaaaatggtcgctgtttggcatacgaga
gatcgtgttaccttagaagcagaattcccaaatgtgaaattttttaatggtttagaagga
cttagagaagtagcgacctatttagatggggacgttcttttaaatgcagttatggggagc
gttggactacttcctacattagatgcaatcgaagctgggaaggccattgcaatagctaat
aaagaaacacttgtcacggctggacatttagttatgcgtgcggcgaaagaaaagaacatt
tctctattacccgttgatagtgaacattctgctattttacaagcattaaacggagaaaat
acggaaagaatcgaaaaaataattttgacagcgagcggtggaagtttccgagataagacg
agggagcaactcagcgcggttacggtgaaagaagcgttaaagcatccgaactggaatatg
gggaataaattaacaattgattcagcaacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtagattacgatgatattgaggtagttatccagcgcgaaagt
attatccattctatggttcagttcgtggatggaagtttcatcgcacaacttggaacgcca
gatatgcggatgccaattcaatatgctttaacctatcccgacagactctatataccgtat
gaaaaagaattccggatcactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttgaatgcggcaaatgaaattgctgttgctggctttttaaatggacaggtagctttt
tataatattgaagcacttgttgagaatgcaatgaatcgtcatactagcatttctaatcct
gacttggatacgattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system