KEGG   Listeria monocytogenes 08-5923: LM5923_1464Help
Entry
LM5923_1464       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K00166  
2-oxoisovalerate dehydrogenase E1 component alpha subunit [EC:1.2.4.4]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LM5923_1464
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     LM5923_1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431743..1432738
Genome map
AA seq 331 aa AA seqDB search
MTLKEAGLTEDKLIKMYETMLMARRLDERMWLLNRSGKIPFTISGQGQETAQIGAAFAFD
LDKDYALPYYRDLAVVLAFGMTAKDIMLSAFAKAEDPNSGGRQMPAHFGQKSNRIVTQSS
PVTTQFPHAAGIGLAAKMAGDEIAIYASTGEGSSNQGDFHEGINFASVHKLPVVFVIHNN
QYAISVPASKQYAAEKLSDRAIGYGIPGERVDGTNMGEVYAAFKRAADRARNGEGPTLIE
TVSYRFTPHSSDDDDSSYRSREEVNEAKGKDPLTIFQTELLEEGYLTEEKIAEIEKNIAK
EVNEATDYAESAAYAEPESSLLYVYDEEANS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaagaagcaggtttaacagaagataaattaattaaaatgtatgaaacaatg
ctaatggcaagaagactagacgagcgtatgtggttgctgaaccgttctgggaaaattcct
ttcaccatttctggacaaggacaagaaacggcacaaattggcgcagcgtttgcctttgat
ttagataaagattacgcattaccatattaccgtgatttagcggtggtgttagcatttggg
atgacagcgaaagatattatgttatccgcgttcgctaaagcagaggatccaaactctggt
ggacgtcaaatgccagctcattttggtcaaaaatcaaatcgcatcgtgacacaaagttca
ccagtaacaacgcagttcccgcatgcagcaggtattggtcttgcagcgaaaatggccggt
gatgagattgcaatttatgcttcaacgggtgaaggatcttctaaccaaggagatttccat
gaaggaatcaacttcgcatctgtacataagttgccagttgttttcgtgattcacaataac
caatatgccatttccgttccagcatcgaaacaatatgctgcagaaaaactatccgaccga
gcaatcggttatggtatcccaggggaacgtgtggatggcacaaatatgggtgaagtatac
gcggcatttaaacgtgcagcagatcgtgcaagaaacggcgagggccccactttaattgaa
acagtttcttaccgattcacaccgcactcttctgatgatgatgacagcagttatcgttcc
agagaagaagtgaacgaagcaaaaggaaaagatccactgacaattttccaaacagaatta
ctcgaagaaggttacttaacagaagaaaaaatcgctgaaatcgaaaaaaatattgcaaaa
gaagttaacgaagcaaccgattacgcggaaagtgcagcatacgctgaaccagaatcatct
ttactttatgtatatgatgaagaagcgaatagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system