KEGG   Listeria monocytogenes 08-5923: LM5923_1630Help
Entry
LM5923_1630       CDS       T01164                                 

Gene name
ruvA
Definition
hypothetical protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1605382..1605987)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEADLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgttgag
gcaggacaaatcggctatcaaataattacagggaacccgttttcctttcaacgactagaa
ggtacagaagcgcaagtctttttgtatcagcatgtgagagaggataatatttctttattt
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcactagccattattgcttcaggcgatgtcgttccactaatttcagcg
attgaatccgaagacgatgtttatttaaccaaatttccgagtgtcggtaaaaaaacagct
cgccaaattattcttgatttaaaaggaaaactggctgatgttgttgcgagcgaaattgtt
tatgttgccccagaaaacgatatggttgcgggactttccccgcaattagaagaggccgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gctaaagaagctgacttaacaagcgacgcatatatcaagctagcgctacaattaatgaca
aaatag

DBGET integrated database retrieval system