KEGG   Listeria monocytogenes 08-5923: LM5923_1652Help
Entry
LM5923_1652       CDS       T01164                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1627439..1628413)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVVSMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAKSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVIEMLT
SMKRAGATLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagtttctatgcctggggtttttcaatatcctttacatgaa
ttagaagaagaaatgcgcgtagttgaaagtcttggtattaaagcggttattttatttggc
attcctgccgaaaaagacgcagttggtacgcaagcttatcacgaccacggaattattcaa
gaagctacaagacttattaaaaaaagttttcctgaaattcttgtggtggctgacacttgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggtgaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgcagcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagctgggttttatgatatcccaattatgtcttatgctgttaaatatgcttctgctttt
tacggaccgttccgtgatgctgctggcagtgcacctcaatttggtgataggaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaaagtcggatgaacaagaa
ggcgcagattttcttattgtaaaaccatcattatcttacttagatatcatgcgcgacgtt
aagaataataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagacgaagaaaaaattgttatagaaatgctaact
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgtatctaaa
tacttaaataaatag

DBGET integrated database retrieval system