KEGG   Listeria monocytogenes 08-5923: LM5923_1662Help
Entry
LM5923_1662       CDS       T01164                                 

Gene name
mutM
Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lmy03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1637937..1638758)
Genome map
AA seq 273 aa AA seqDB search
MPEMPEVENVRATLQELVPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKF
LLFDLTNCTILSHLRMEGKFRLMDENEEVSKHTHIIFHFEDHTELRFLDVRKFGTMEVTN
KYGEGETRSIKKLGPEPLTQAFTLTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEIC
FEAKVRPERAANSLSDKEIKRIFKATKSIMTEAVALGGSTVRTYVNSQGKLGQYQNKLKV
YGKTDEPCVVCGTPIEKIKLNGRGTHFCPNCQK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatgccggaagtagaaaatgtccgcgcaacattacaagaattagtcccaggt
aaaaaaatagatcaagtaatagttcgtgttccaaaaatgattgtctcaacaccacccgat
gagtttgtgcatatgcttgtcgggcaagaaatagagggtgtgcgccgtcgtggtaaattc
ttactttttgacttaaccaactgtacgattttatcgcatttacggatggaaggtaaattt
cggttaatggatgaaaatgaagaggtcagcaagcatacgcatattatttttcattttgag
gatcacacggaattgcgttttttagatgtgcgaaaatttggtacgatggaagtaacgaat
aaatacggtgagggtgagactcggtcgattaaaaagcttggcccagaaccgctgacgcaa
gcttttacactaacggattttgcaactggtgtgaaaaaaacaagccgcgccatcaaaacg
gctttacttgatcaaaagttagtagcgggagttggaaatatttatgcggatgaaatttgt
tttgaagcaaaagtacgaccggaaagagcagctaactcactttcagacaaagaaattaaa
cgtatttttaaagcgacgaaaagtattatgactgaagctgtagcacttggtggctccact
gttagaacgtatgtgaattcgcaaggtaagcttggacaatatcaaaataaattaaaagta
tacggcaaaacagacgagccgtgtgttgtttgtggaacgccgattgaaaaaatcaaatta
aatggacgtgggacacatttttgcccgaattgccaaaaatag

DBGET integrated database retrieval system