KEGG   Listeria monocytogenes 08-5923: LM5923_1729Help
Entry
LM5923_1729       CDS       T01164                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LM5923_1729 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LM5923_1729 (trpC)
Enzymes [BR:lmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LM5923_1729 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1709577..1710335)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKEVEVAKMPLEQVAEKRKTYSFYEFLKANTNTMQLIAEVKRASPSKGEIN
MGVNPVQQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVGIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEKLITLFEQALALDLEVLVEVHDQEELAVAQKIGAQLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYDAVLVGEALMREAT
PEVAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagaagtagaagttgcaaaaatgccctta
gaacaagtagcagaaaaacggaaaacttattcgttttatgaatttttaaaagcaaataca
aacacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccagttcagcaagccaagtcttatcaagccgcgggtgcgggaatgatt
tctgttttgacagatcctgtttttttcaaaggttcgattgaagatttgcgagaagtagcg
aaaaatgtgggaattcctgtactctgtaaagatttcattattagtgaaaaacaattgatt
cgcgctcgaaatgcgggagcgacggttgtgttgttaattatttcggcacttacagaagag
aagctaatcaccctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccaggaagaattagctgttgctcaaaaaatcggagctcaactcattggtgtaaac
aatcggaatttgcacacatttgaagtggatattgcagtaagcgaaagactggcgagtgat
ttttcgtcggatgcttgttttataagcgaatcaggttttcgaacagcagaagatgtggct
cgcgtgagtcaaaaatatgatgcggtacttgttggagaagcgttaatgcgagaagcgact
ccagaagtggcagcgaagagtttgaaggtgacacgatga

DBGET integrated database retrieval system