KEGG   Listeria monocytogenes 08-5923: LM5923_1762Help
Entry
LM5923_1762       CDS       T01164                                 

Gene name
ansB
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lmy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750403..1752268)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDDKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNNLARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaatagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgc
cttcgcgggatgtttggttttgttatttgggacaaacaagaagaacttgtttacggcgca
cgcgacccattcggcattaaaccatttttctatgcagaagaagacgacaagctgttcatg
ggttctgaaaagaaatccattttacatgcgttaaaagaaaaagaattggacgaagtgtca
ttacaaaactatatgacttaccaatttgttccagaaccagattccttaactaaaaatgtc
aaacggttagagccaggacatcagtttacgaaaaaaattggtcaaccgatggaaattacg
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggatcaaagaa
gtgcgtgacgtgatgtatgattctgttaaaatgcacatgcgctctgatgtaccagttggt
tcattcctatctggcggtattgattcatcgattattgcagcaattgccaaagaataccac
ccagcaatcaaaacattctcagttggttttgaacgcgatggtttcagtgaaatcgatgta
gcaaaagaaacagcggacaaacttggcgtagaaaacattagttatgttatctcaccagaa
gaatatatgaaagaactaccgaaaattgtttggcacatggatgatccacttgctgacccg
gctgctattccgctttatttcttatcaagagaagcgcgcaaacaagtaaccgtagcatta
tcaggtgaaggcgcagatgaacttttcggtggttataacatttataacgaaccaaattcc
cttgcaatgtttaacaaaatgccaggcgtatttaaatcaatgttaaataacttggcgcgt
attatgccagaaggaatgcgtggtaaaagtttcttagaacgtggaacaacgccgatggaa
gaacgttatatcggaaacgccaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaataccaagctggacatgactatacgaatattacagatccattttatgcagaaacaacg
aattatcatcctgtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctcaaagctgaccgcatgacgatggctaattcgctggaagtccgtgtacctttc
cttgataaagaagtgtacaacgtggcaagaaatattccagatacaatgaaaacaaccaat
ggaacaaccaaatatatcttacgtaaagcggcagcaacatttgtaccagaacacgtactt
aaccgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaacatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gtgctagacttactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtacgatgtatacgtagcagacaaatacgacttcgga
aaataa

DBGET integrated database retrieval system