KEGG   Listeria monocytogenes 08-5923: LM5923_1961Help
Entry
LM5923_1961       CDS       T01164                                 

Gene name
fabD
Definition
ACP S-malonyltransferase
Orthology
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LM5923_1961 (fabD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    LM5923_1961 (fabD)
Enzymes [BR:lmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     LM5923_1961 (fabD)
Lipid biosynthesis proteins [BR:lmy01004]
 Fatty acid synthase
  Component type
   LM5923_1961 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1967310..1968251)
Genome map
AA seq 313 aa AA seqDB search
MTKIAFVFPGQGAQKIGMGQDVAAEYPEAKKIYDDADERLGFSITEIITEGPIELLTKSE
NAQPALVSTSVAILRALETYGVKADYVAGHSLGEYSALVAGGFLEASDAIYLVRKRGELM
EAAVPNGAGAMAAVLGVDRETLKTITEEVTKEGDAVQLANLNCPGQIVISGTTAGVEKAG
EKAKESGAKRVLPLAVSGPFHSSLMEPAALAFREILAEVEISDGNIPVVNNVDAKQTTDK
AEISDKLIKQIYSPVLWEDIVEELIKNGVDTFVEIGSGKVLAGLIKKINRDVTVLSAGDA
ESVKSVAATLKGE
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaattgcatttgtatttcccggtcaaggagcacaaaaaattggcatgggacaa
gatgtagcagcagaatatcctgaagcaaaaaaaatctatgatgatgctgacgaaagactc
gggttttcaatcacagaaattattacagaaggtccaattgaattattaacgaaatccgaa
aacgcacaaccagcattagtttccacaagtgttgctattttacgcgctttagaaacatat
ggtgtgaaagctgattacgtagcgggacatagtcttggtgaatatagtgcgcttgttgct
ggcggatttttagaagcaagtgatgcgatttaccttgtacgtaaacgcggtgaattaatg
gaagcagctgtgccaaatggtgctggcgcaatggctgcagttcttggtgtagaccgggaa
acattaaaaacaatcaccgaagaagtaactaaagaaggcgatgcagtacaacttgctaac
cttaactgcccaggacaaatcgttatttccggaacaacagctggcgttgaaaaagcaggc
gaaaaagcaaaagaaagtggtgcaaaacgcgtattaccacttgctgttagcggacctttc
cactctagcttaatggaaccagccgcacttgctttccgtgagattttagcagaagtagaa
atttcagatggtaacattccagttgttaacaatgtggatgccaaacaaactactgataaa
gcggaaattagtgataaattaatcaaacaaatttactctccagtactatgggaagatatc
gtcgaagaactaattaaaaacggcgtagatacgtttgtcgaaattggttctggaaaagtg
ttagcgggtttaattaaaaaaatcaatcgtgatgtaactgtactgtcagcaggtgacgct
gaatcagtgaaaagcgttgcagcgacattgaaaggagaataa

DBGET integrated database retrieval system