KEGG   Listeria monocytogenes 08-5923: LM5923_1991Help
Entry
LM5923_1991       CDS       T01164                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lmy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lmy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000357..2001268)
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLEQAAQFKRGKKATFNEQTFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYEGLENLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESCLAYGTYLPVDEVVEKVDVMMLLRVQHERHSGTEAFTKESYHEKFGLTIERAA
KLKADAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattagag
caggcggcacagtttaaacgcgggaaaaaagcgacttttaatgaacagactttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcggagaaaaag
ttaggagtcgaggtggtttcctttgatgctgcgagctctagcatgaccaaaggggagacg
ctctacgacactctgctcaccatgcaagcagttggagtgaatgtggcagtaatcaggcat
tcagaagaaaactattacgagggtcttgaaaacttagatattgctattgtaaacggcggg
gatggctgtggggaacatccgagccaatcattactcgacttatttacgataaaggagcaa
tttggtacttttcaagggttgaaagtagcgattgctggtgatatcaggcacagccgagtc
gccaattccaatatgaaagtgctaaaaagacttggagcggaactgtttttctcgggaccg
agagaatggtttgacgaaagttgcttagcatatggcacctacttgccggtcgatgaggtg
gtagaaaaagttgatgtgatgatgctattacgggtacaacatgagcgccatagtggaaca
gaggcgtttacgaaagaaagctatcacgaaaaatttggtttaacgattgagcgggcggca
aagctaaaagcagatgcgattattatgcacccaagtcctgtaaaccgagatgtggaaatc
gctgatagcttagttgaaagcgaaaaatcacgcattgttacgcaaatgacaaatggcgtt
tttataagaatggccattttggaagctattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

DBGET integrated database retrieval system