KEGG   Listeria monocytogenes 08-5923: LM5923_2026Help
Entry
LM5923_2026       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LM5923_2026
   00670 One carbon pool by folate
    LM5923_2026
Enzymes [BR:lmy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LM5923_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2032600..2033082)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLHFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggaaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcattttttcaaaaaaacaacgactgggaaaacactt
gtcatggggcggaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttttagcccttgctgagacaggggaaccaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctgaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system