KEGG   Listeria monocytogenes 08-5923: LM5923_2287Help
Entry
LM5923_2287       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:lmy01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmy01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmy00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:lmy00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lmy00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:lmy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2301872..2302771)
Genome map
AA seq 299 aa AA seqDB search
MLVNMKQLLEVAKENKFAVGAFNVADSNFLRVVVEEAEKNNAPAIIAVHPTELDFTKDDF
FQYVLARIKNSPVPFVLHLDHGDNMGDVMRAVRCGFSSVMIDGSLLPFEENIRVTKEVVD
VCHKLGVSVEGELGTIGKTGNSIEGGVSEIIYTKPEEAEEYISRTGVDTLAVAIGTAHGI
YPKDKEPKLRLDILKEIKALVNIPLVLHGGSANPDAEIAAAVEIGIQKVNISSDYKYAFY
KKCREILSTTELWDANAIYPDCIDAAKEVVKYKMGLFESIGQVEKYQQAKTTAWRSELI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttagtaaatatgaaacaattattagaagtagctaaagaaaacaaattcgcggtggga
gcatttaatgtagcagacagtaactttttacgggtggtagtagaagaagctgaaaaaaac
aatgctccagcaattattgctgtgcatccaacagaattagattttacgaaagatgatttt
ttccaatatgtccttgcaagaattaaaaatagtcctgttccatttgtccttcatttagat
catggtgacaatatgggagatgtgatgcgagcggtgcgttgtggttttagttcagtgatg
attgatggctctttacttccttttgaagaaaatattcgagttacaaaggaggttgtagat
gtctgtcataaactgggggtttcagttgaaggagagctcgggactatcgggaaaactggt
aacagtattgaaggcggcgtcagtgagattatctatacaaaacccgaagaagcagaagaa
tatatcagccgtacgggggtagatacgctagctgttgcgattgggacagcacacgggatt
tatcctaaagataaagagccaaaattacggctagatatcttaaaagaaataaaagcttta
gtgaatattccgcttgtacttcacggtggttctgcaaatccagatgcagaaattgctgcg
gctgtcgaaattggaattcaaaaagtaaatatttccagcgattacaaatacgccttttat
aagaaatgtcgtgaaattctaagtacaacagaactttgggatgcaaacgcaatctaccca
gactgtattgatgcggcgaaagaagtggtgaagtataagatgggactttttgagtctatt
ggtcaagtagaaaaataccaacaagcaaaaactacagcttggcgaagtgaactaatctaa

DBGET integrated database retrieval system