KEGG   Listeria monocytogenes 08-5923: LM5923_2287Help
Entry
LM5923_2287       CDS       T01164                                 

Definition
hypothetical protein
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LM5923_2287
   01230 Biosynthesis of amino acids
    LM5923_2287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_2287
   00030 Pentose phosphate pathway
    LM5923_2287
   00051 Fructose and mannose metabolism
    LM5923_2287
  Energy metabolism
   00680 Methane metabolism
    LM5923_2287
Enzymes [BR:lmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LM5923_2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2301872..2302771)
Genome map
AA seq 299 aa AA seqDB search
MLVNMKQLLEVAKENKFAVGAFNVADSNFLRVVVEEAEKNNAPAIIAVHPTELDFTKDDF
FQYVLARIKNSPVPFVLHLDHGDNMGDVMRAVRCGFSSVMIDGSLLPFEENIRVTKEVVD
VCHKLGVSVEGELGTIGKTGNSIEGGVSEIIYTKPEEAEEYISRTGVDTLAVAIGTAHGI
YPKDKEPKLRLDILKEIKALVNIPLVLHGGSANPDAEIAAAVEIGIQKVNISSDYKYAFY
KKCREILSTTELWDANAIYPDCIDAAKEVVKYKMGLFESIGQVEKYQQAKTTAWRSELI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttagtaaatatgaaacaattattagaagtagctaaagaaaacaaattcgcggtggga
gcatttaatgtagcagacagtaactttttacgggtggtagtagaagaagctgaaaaaaac
aatgctccagcaattattgctgtgcatccaacagaattagattttacgaaagatgatttt
ttccaatatgtccttgcaagaattaaaaatagtcctgttccatttgtccttcatttagat
catggtgacaatatgggagatgtgatgcgagcggtgcgttgtggttttagttcagtgatg
attgatggctctttacttccttttgaagaaaatattcgagttacaaaggaggttgtagat
gtctgtcataaactgggggtttcagttgaaggagagctcgggactatcgggaaaactggt
aacagtattgaaggcggcgtcagtgagattatctatacaaaacccgaagaagcagaagaa
tatatcagccgtacgggggtagatacgctagctgttgcgattgggacagcacacgggatt
tatcctaaagataaagagccaaaattacggctagatatcttaaaagaaataaaagcttta
gtgaatattccgcttgtacttcacggtggttctgcaaatccagatgcagaaattgctgcg
gctgtcgaaattggaattcaaaaagtaaatatttccagcgattacaaatacgccttttat
aagaaatgtcgtgaaattctaagtacaacagaactttgggatgcaaacgcaatctaccca
gactgtattgatgcggcgaaagaagtggtgaagtataagatgggactttttgagtctatt
ggtcaagtagaaaaataccaacaagcaaaaactacagcttggcgaagtgaactaatctaa

DBGET integrated database retrieval system