KEGG   Listeria monocytogenes 08-5923: LM5923_2287Help
Entry
LM5923_2287       CDS       T01164                                 

Definition
(RefSeq) hypothetical protein
  KO
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LM5923_2287
   01230 Biosynthesis of amino acids
    LM5923_2287
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_2287
   00030 Pentose phosphate pathway
    LM5923_2287
   00051 Fructose and mannose metabolism
    LM5923_2287
  Energy metabolism
   00680 Methane metabolism
    LM5923_2287
Enzymes [BR:lmy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LM5923_2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2301872..2302771)
Genome map
AA seq 299 aa AA seqDB search
MLVNMKQLLEVAKENKFAVGAFNVADSNFLRVVVEEAEKNNAPAIIAVHPTELDFTKDDF
FQYVLARIKNSPVPFVLHLDHGDNMGDVMRAVRCGFSSVMIDGSLLPFEENIRVTKEVVD
VCHKLGVSVEGELGTIGKTGNSIEGGVSEIIYTKPEEAEEYISRTGVDTLAVAIGTAHGI
YPKDKEPKLRLDILKEIKALVNIPLVLHGGSANPDAEIAAAVEIGIQKVNISSDYKYAFY
KKCREILSTTELWDANAIYPDCIDAAKEVVKYKMGLFESIGQVEKYQQAKTTAWRSELI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttagtaaatatgaaacaattattagaagtagctaaagaaaacaaattcgcggtggga
gcatttaatgtagcagacagtaactttttacgggtggtagtagaagaagctgaaaaaaac
aatgctccagcaattattgctgtgcatccaacagaattagattttacgaaagatgatttt
ttccaatatgtccttgcaagaattaaaaatagtcctgttccatttgtccttcatttagat
catggtgacaatatgggagatgtgatgcgagcggtgcgttgtggttttagttcagtgatg
attgatggctctttacttccttttgaagaaaatattcgagttacaaaggaggttgtagat
gtctgtcataaactgggggtttcagttgaaggagagctcgggactatcgggaaaactggt
aacagtattgaaggcggcgtcagtgagattatctatacaaaacccgaagaagcagaagaa
tatatcagccgtacgggggtagatacgctagctgttgcgattgggacagcacacgggatt
tatcctaaagataaagagccaaaattacggctagatatcttaaaagaaataaaagcttta
gtgaatattccgcttgtacttcacggtggttctgcaaatccagatgcagaaattgctgcg
gctgtcgaaattggaattcaaaaagtaaatatttccagcgattacaaatacgccttttat
aagaaatgtcgtgaaattctaagtacaacagaactttgggatgcaaacgcaatctaccca
gactgtattgatgcggcgaaagaagtggtgaagtataagatgggactttttgagtctatt
ggtcaagtagaaaaataccaacaagcaaaaactacagcttggcgaagtgaactaatctaa

DBGET integrated database retrieval system