KEGG   Listeria monocytogenes 08-5923: LM5923_2359Help
Entry
LM5923_2359       CDS       T01164                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmy  Listeria monocytogenes 08-5923
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LM5923_2359
   01230 Biosynthesis of amino acids
    LM5923_2359
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_2359
  Energy metabolism
   00680 Methane metabolism
    LM5923_2359
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LM5923_2359
Enzymes [BR:lmy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LM5923_2359
Exosome [BR:lmy04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LM5923_2359
  Exosomal proteins of melanoma cells
   LM5923_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2377659..2378348)
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGISDDEIMDLEIPTGVPLVYELNDDLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaacctatttaca
ggttggcatgatgtggacttgtcgcaagaaggcgttgtggaagcaatgacagcaggaaaa
agaattaaagaggcaggcttagaattcgatgttgccttcacttctgttttaacacgagct
attaaaacacttaattatgtgttagaagaatctgaccaaatgtgggtaccagttcataaa
tcttggcgcttgaacgaacgtcattacggcgcacttcaaggacttaataaacaagaaact
gctgaaaaatatggtgctgaccaagtacaaaaatggcgtagaagctatgacacacttcca
ccattactagaagaaaacgacgaaagacaagcaaaaaatgatcgtcgttatcaactcctt
gatacacacgctattccatcaggtgaaaacttgaaagtaacattagaacgcgttattcct
tattggatggacacaattgctccagaaattaaagaaggacgacgagtagtcatcgcggcg
catggtaacagtttacgagcattagtgaaattcctagaaggtattagtgatgatgaaata
atggatttagaaattccaacaggcgtaccactagtatatgaattaaacgatgatttaaaa
ccagtaaataaatattacttggataaataa

DBGET integrated database retrieval system