KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0258Help
Entry
LMOSLCC2482_0258  CDS       T02221                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275227..276669
Genome map
AA seq 480 aa AA seqDB search
MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAVGGIHLLPFFPSTGDRGFAPSDYTTV
DSDLGSWEIIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLNSKYKDMFIRINDFFPP
GRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQIDLDVTAEVTKEFIRQTIK
NMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKAEAAKYDMELLPEIHEHYS
IQMKIANHDYYIYDFALPMVMLYSLYSGRVERLANWLEMSPMKQFTTLDTHDGIGVVDAR
DLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQINSTYYSALGDDDKSYLLARVI
QCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTIDEIKNEVKRPVVKALCNLL
RFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITATLKANLSTKTFQISENERNILI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattaaaaataaagctatgttaattacttattctgatagtttagggaaaaatatg
gaagaattatccaaggtgatggaaacttattttgaagatgctgttggcgggattcactta
ttgccgttctttccatccactggagatcgagggtttgcgccaagtgattacacaacagta
gatagcgacctaggttcttgggaaataatcgagaaattaggcgaaaagtattatttaatg
tttgattttatgattaatcacatttctcgcgaatcactcttctttcaagattttaaaaaa
gagcatttaaactcaaagtataaagatatgtttattcgtatcaatgatttctttcctccg
ggtagaccaaatgaaaaagacttagatttaatttataagagaaaagataaggcgcctttt
caagaagttgaatttgctgatggggaaacggaattagtttggaatacttttggggaagaa
caaattgatttagatgtgacagccgaagttacaaaagaatttattcgtcaaacgataaaa
aatatggctgcacatggttgttctattttgcgtcttgatgcctttgcttatgcaattaaa
aaattagatacaaatgatttttttgtagaaccggaaatttgggatttactggatgaagtg
aaagcagaagcggccaaatatgacatggaattattaccagaaattcatgaacattattcc
atccaaatgaaaatcgcgaaccatgattattatatctatgattttgcgttacccatggtg
atgctgtactcgttatatagtggccgagtggaacgtttagctaactggttagaaatgagt
ccgatgaagcaatttactactttagatacgcatgatggcattggcgttgtggatgcacgc
gatttattaacagatgaggaactcgattatacttcagcagaattatacaaaataggagct
aatgttaaaaagatatattcctctgaaaaatataataacctggatatttatcaaattaat
agtacctattatagtgctttgggtgacgatgataaaagttacttgttagcgagagtaatt
caatgttttgcgccggggattccgcaaatttattatgttggtttacttgctggcaaaaat
gatattgaccttttagaggaaacaaaagaagggcgtaatattaatcgtcattactacaca
atagatgaaattaaaaatgaagtaaaaagaccagttgttaaagcgttgtgcaatttactg
aggtttagaaatacttctgaagcgtttgatttggaaggaagtatagaaattgagacacct
agctcaaatgaaatcgttattattcgcaaaaacaaaacaaataaaattacagcgacatta
aaagcaaatttaagtactaaaacattccaaatcagcgaaaatgaaagaaatattttaatt
taa

DBGET integrated database retrieval system