KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0324Help
Entry
LMOSLCC2482_0324  CDS       T02221                                 

Definition
glycosyl hydrolase family protein (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmz00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(351338..352753)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPANFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccaactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggatttggtcacattactgacggtccaacaccagataacttaaaattagaagga
attgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgacgaaactgagcca
aacgaagcagggctacaattttacgatgatttattcgacgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcatttatcgaaaacttacgac
ggatgggtaaatagaaaaatgatcgatttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactccattttacac
gcaccattcatgagcggcggtatttctacaagcccagataaattatcacaaaaagaccta
taccaagctgtccaccacgaacttgtggcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagcccaaatcggctgcatggtcctagcaatgccaacttatccgctaact
tccaacccagatgatattattgctgttatggaagcagagcgcaaaaactacttcttctcc
gacgttcatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcaaaacgcaaagctggc
gcaggaaacatcctaggcggcgtacaaaacccttacctagaagcatccgaatggggctgg
caaatcgaccctcaaggcttgcgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaac
ggcaactacacagtaaatgatgactaccgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gatcttgtaagtgcctccactgctgaaatgaaaaaacgttacggctttatctatgtcgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aagaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system