KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0348Help
Entry
LMOSLCC2482_0348  CDS       T02221                                 

Gene name
tpiA-1
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00010  Glycolysis / Gluconeogenesis
lmz00051  Fructose and mannose metabolism
lmz00562  Inositol phosphate metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz01130  Biosynthesis of antibiotics
lmz01200  Carbon metabolism
lmz01230  Biosynthesis of amino acids
Module
lmz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2482_0348 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOSLCC2482_0348 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOSLCC2482_0348 (tpiA-1)
Enzymes [BR:lmz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC2482_0348 (tpiA-1)
Exosome [BR:lmz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC2482_0348 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOSLCC2482_0348 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOSLCC2482_0348 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY02869
Position
complement(383626..384390)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttaaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatctatcattgatctaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcgaagaagattaaacttgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccgtgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaagcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggagtgggcaattggaaaggcgtcttcagctgag
acaaactacatcgaaagcgcgcatcaagcgctgcgtgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system