KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0927Help
Entry
LMOSLCC2482_0927  CDS       T02221                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00860  Porphyrin and chlorophyll metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOSLCC2482_0927 (hemG)
Enzymes [BR:lmz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMOSLCC2482_0927 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     LMOSLCC2482_0927 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 NAD_binding_9 Pyr_redox_3 HI0933_like FAD_binding_2 Pyr_redox_2 Pyr_redox FAD_oxidored Trp_halogenase GIDA
Motif
Other DBs
NCBI-ProteinID: CBY03448
Position
958164..959543
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDKKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYYQKALHPIPEGSVMGIPTDKEALLASKLVS
EIGKARALQEPTMERNNQEQDQALGEFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQAVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATNITKKNSSYEISFVDGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEMMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggcttgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacaaaaaactaggcggg
aaatttgaaacggttaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcctacatttactaccaaaaagcacttcatccgattccagaa
ggctcagtgatgggaattccaacagataaagaagcattgctagctagtaaactcgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacaa
gatcaagcacttggcgaattctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggagatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaagcagttaaaaaatatgggaatttgatggatggcttaaaa
gaaagtagcatgcaaacgacagggacaaaagctactattggtgcttttcgaacattagaa
ggcgggctagatgcgttaccaaaagccattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacgaacattacgaaaaagaatagctcttacgaaatttcttttgta
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgctaatt
catttattagcagaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagatggaacaggctat
ctagttgccagaaccgctccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccagaaaataaaatgttactacgaggctttgttgggaaagcgggagaa
acttggttagagcaagcaagtgatgaagcaatcgtttcagctgttttgagagattatgcg
gaaatgatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgca
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
gcagattacccaggggtttattttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggagctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system