KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_0963Help
Entry
LMOSLCC2482_0963  CDS       T02221                                 

Gene name
bglH
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2482_0963 (bglH)
Enzymes [BR:lmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC2482_0963 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988085..989536
Genome map
AA seq 483 aa AA seqDB search
MFENYQFPKDFLWGGAIAANQAEGAFKVDGKGISLADLHKYHKGKTNDEISEEQHKGVSL
ADIKASMEDKVNYYPKRHGIDFYHTYPEDLALLAEMGFKTFRTSLDWTRIFPTGEETEPN
EAGLKYYDQLIDKIIELGMEPIITILHYETPVEIVLNHGGWHNRKVIDLFEKYGKTVLDR
YNKKVKYWIIINQINLIQFEPFNSTAIPYDAVDDYLSATYQAVHNQFVASAKIYEYGKAL
NPDLMIGTMLADCTAYPFSCDPDDIVLAMKRNRMEYFFADVQFQGEYPQYALNYFDENNI
HIEITEDDKAILQKNTMDYLALSYYYSQMVDSKKNDLDPASITPNPHLKANPWGWAVDPK
GLYNALSQYWDRYHKPIIIAENGFGMYDKLENGEIHDDYRIDYLSAHLKEMKRAMYDGVE
IIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGTGKRIKKDSFSWYKKVIESNGED
LEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaattatcaatttccaaaagactttttatggggaggagctatcgcagccaac
caagcagaaggcgcatttaaagtagatggaaaaggaattagtttagcagatttgcacaaa
tatcataaagggaaaacaaatgatgaaatcagtgaggaacaacataaaggtgtaagtttg
gctgatatcaaagcaagtatggaagacaaagtgaactattatccgaaacgccacggtatc
gacttttatcacacgtatccagaagatttggctttgcttgctgaaatgggctttaaaaca
tttcgaacttcgctggactggacacggatttttccaactggcgaagaaacagaaccaaat
gaagcgggattaaaatattatgaccaattaattgataaaattatcgaacttggcatggag
ccaattattacgatattacattacgaaacgccggtggaaattgtcttaaatcatggcggt
tggcataatcgtaaagttattgatttatttgagaagtacggcaaaacggtacttgatcgc
tacaataaaaaagtaaaatattggattatcattaaccaaattaatttaattcaattcgaa
ccatttaactctactgcgattccatatgatgccgtcgatgattatttatccgctacgtat
caagctgttcataaccaatttgttgcaagtgcgaaaatttacgaatacggaaaagcgcta
aatcctgatttaatgattggtacaatgctcgctgattgcacagcctatccattctcctgc
gatccagatgatatcgtactcgcaatgaaacgcaaccgcatggaatatttcttcgcagac
gtgcagttccaaggcgaatatccacagtatgcgcttaattactttgacgaaaataatatt
catatagaaatcacagaagacgacaaagccattttacaaaaaaacaccatggattattta
gcactttcctattattattcccaaatggtggactccaagaaaaatgatttggacccagct
tcgattacaccaaacccgcatcttaaagctaatccgtggggctgggcagtcgatccgaaa
ggcttgtataacgcattgtcgcagtactgggacagatatcataaaccaattatcattgcc
gaaaatggttttggaatgtatgacaaattagaaaatggcgaaatccatgatgattaccgg
attgattatttatccgcgcatctaaaagaaatgaaacgcgccatgtatgacggcgtagaa
attatcgcatattgcgcttggggaccgattgatatagttagttgctcctccgcacaaatg
gaaaaaagatacggtttcatttacgttgatttagataacgaaggaaacggtacaggcaaa
agaattaaaaaagacagcttttcatggtataaaaaagtaatagagtctaatggggaagac
ttagaagcttaa

DBGET integrated database retrieval system