KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1101Help
Entry
LMOSLCC2482_1101  CDS       T02221                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOSLCC2482_1101 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2482_1101 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LMOSLCC2482_1101 (pdhC)
   00620 Pyruvate metabolism
    LMOSLCC2482_1101 (pdhC)
Enzymes [BR:lmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMOSLCC2482_1101 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115933..1117567
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPVTGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAASTTTAQTEEKAAAPKAEKA
AAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataagattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacgattaaagaaatcaaa
gttgcagaaggtacagttgctacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggcgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtacaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgttaaagatattttagttagcgaaggaacagtagcaacggttggt
caagtattagtaacattcgaaggcgattttgaaggagaagctagtcatgaatctactcca
gaatctccagcagaagaagctgaacttacaaacaacgatgcaacttccgctccagttaca
ggtggaaacggaacgccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgcgcgtgaaaaaggcgttaatatcgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggcgaacaaccagct
gcatcaacaactactgctcaaacagaagaaaaagcagcagcaccaaaggcagaaaaagca
gcagcaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcgattgcaaaagcaatggtaaattcaaaacatacagctccacacgtt
actttaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaactaactttcttaccttatatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatatgta
ccagtaattaaaaatgctgataaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggtggacaatggttcactccagtaattaattaccca
gaagttgctatcctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtacttgctctttccttgagctttgaccaccgtgtaattgacggc
gcaactgctcaaaaagcaatgaacaatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system