KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1308Help
Entry
LMOSLCC2482_1308  CDS       T02221                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lmz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1305398..1306228)
Genome map
AA seq 276 aa AA seqDB search
MRESLKNSKRLVIKVGTSTLMYGNGHINLRTIEKLAMVLSDLRNEGKEVILVSSGAIGVG
CHKLQLSVRPTSIPDLQAVASVGQSELMHIYSKFFGEYGQVVGQVLLTRDVTDFPISREN
VMNTLDSLLSRGIIPIVNENDTVAVEELEHVTKYGDNDLLSAIVAKLVQADLLIMLSDID
GFYGSNPATDPEAVMFSEINQITPEIEALAGGRGSKFGTGGMLTKLSAASYCMDSNQKMI
LTNGKNPTVIFNIMQGEQIGTLFASKKEELSHDRTH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatctttaaaaaatagtaagagattagtcatcaaagttggtacaagtacatta
atgtatggaaatggccatattaatttacgtactatagaaaaattagcaatggttttatcc
gatttacgtaacgaaggaaaagaggtcattcttgtttcttctggggcaatcggtgttggt
tgtcataaattacagctttcagtaagacctacaagtatccctgaccttcaagctgtcgcg
tcggttggtcaaagtgaactaatgcatatttatagtaaattttttggtgaatatggacaa
gtggttggacaggtgttgcttacacgtgatgtaactgacttccctattagccgcgaaaat
gttatgaatactttagacagtttattaagccgtggtattatccctatcgtaaatgaaaat
gataccgttgctgtagaagaactggagcatgtaacgaaatacggggataatgatcttctt
tcagccattgtcgctaaactggttcaagctgatttgcttattatgctttctgatattgac
ggcttttatggtagtaaccctgcaacagatccagaggctgttatgttctctgaaatcaac
caaatcactccagaaattgaagcccttgctggaggacgcggttctaaatttgggactggt
ggtatgttgaccaagctttctgctgcttcttattgtatggattctaaccaaaaaatgatt
ttaacaaacggtaaaaaccctaccgtcatttttaatattatgcaaggtgaacaaattggt
actttattcgcaagtaaaaaggaggaactttcacatgaccgaactcattaa

DBGET integrated database retrieval system