KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1391Help
Entry
LMOSLCC2482_1391  CDS       T02221                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00010  Glycolysis / Gluconeogenesis
lmz00052  Galactose metabolism
lmz00500  Starch and sucrose metabolism
lmz00520  Amino sugar and nucleotide sugar metabolism
lmz00521  Streptomycin biosynthesis
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz01130  Biosynthesis of antibiotics
lmz01200  Carbon metabolism
Module
lmz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2482_1391 (glcK)
   00052 Galactose metabolism
    LMOSLCC2482_1391 (glcK)
   00500 Starch and sucrose metabolism
    LMOSLCC2482_1391 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOSLCC2482_1391 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOSLCC2482_1391 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMOSLCC2482_1391 (glcK)
Enzymes [BR:lmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMOSLCC2482_1391 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CBY03912
Position
1384592..1385560
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEEKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagaaaagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgccgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaataacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system