KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1628Help
Entry
LMOSLCC2482_1628  CDS       T02221                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00010  Glycolysis / Gluconeogenesis
lmz00030  Pentose phosphate pathway
lmz00051  Fructose and mannose metabolism
lmz00052  Galactose metabolism
lmz00680  Methane metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz01130  Biosynthesis of antibiotics
lmz01200  Carbon metabolism
lmz01230  Biosynthesis of amino acids
lmz03018  RNA degradation
Module
lmz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2482_1628 (pfk)
   00030 Pentose phosphate pathway
    LMOSLCC2482_1628 (pfk)
   00051 Fructose and mannose metabolism
    LMOSLCC2482_1628 (pfk)
   00052 Galactose metabolism
    LMOSLCC2482_1628 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2482_1628 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMOSLCC2482_1628 (pfk)
Enzymes [BR:lmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMOSLCC2482_1628 (pfk)
Protein phosphatases and associated proteins [BR:lmz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMOSLCC2482_1628 (pfk)
Messenger RNA biogenesis [BR:lmz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LMOSLCC2482_1628 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBY04149
Position
complement(1628362..1629321)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggtgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggccttgtggttatt
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaacactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgtgacgctggtgatatcgctctttggtct
ggacttgctggtggtgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtcgtt
gctgagggcgtaatgtccggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcacgttcagtagaattattgttagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatctattttgtcgatttaa

DBGET integrated database retrieval system