KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_1935Help
Entry
LMOSLCC2482_1935  CDS       T02221                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmz00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lmz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1964972..1965454)
Genome map
AA seq 160 aa AA seqDB search
MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTI
VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF
EADTAFPEVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatttttgtttgggcacaagaccgcgctggtaatattggaaaagataacaaaatg
ccgtggcacttaccaggagatttgcagtttttcaaaaaaacgacgactgggaaaacactt
gtcatggggcgaaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc
gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa
gctgttttagcccttgctgagacgggggaaccaatctatatagttggtggtgcagaaatc
tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt
gaggctgatactgcgtttcctgaagtggattgggagaatttttccgaagtggcgaaagaa
ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat
tag

DBGET integrated database retrieval system