KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_2550Help
Entry
LMOSLCC2482_2550  CDS       T02221                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00260  Glycine, serine and threonine metabolism
lmz00750  Vitamin B6 metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz01230  Biosynthesis of amino acids
Module
lmz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2482_2550 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOSLCC2482_2550 (thrC)
Enzymes [BR:lmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOSLCC2482_2550 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C
Motif
Other DBs
NCBI-ProteinID: CBY05071
Position
complement(2603924..2604979)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWELAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacacca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
ctgggtgttactttatacggaaaatatgaaggcttaaatccaaccggttcttttaaagac
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tacggcgcagatattatctcaattcaaggtaattttgatgaagcgttaaaatcggttcgt
gaactggctgaaacagaagcagtaacgcttgtaaactcggtaaatccttatcgtttagaa
ggtcaaaaaacagctgcattcgaaatttgtgagcaattaggttctgctccagatgtcctt
gcaatcccagtaggtaatgccggaaacatttctgcctactggaaagggtttaaagaatgg
aatgaggccaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggct
gcgattgttcaaggtaaaccgattgataatccggaaacaattgcaacggcgattcgtatc
ggaaatccagctagttgggagcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgtaaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccaggttcagccgcttcattagctggtgtcatccaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagtagtttgtgtctttactggaaacggcttgaaagat
ccggatactgcgatgagtgtgcatgaaattccgatttctcatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system