KEGG   Listeria monocytogenes serotype 7 SLCC2482: LMOSLCC2482_2742Help
Entry
LMOSLCC2482_2742  CDS       T02221                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmz  Listeria monocytogenes serotype 7 SLCC2482
Pathway
lmz00010  Glycolysis / Gluconeogenesis
lmz00620  Pyruvate metabolism
lmz00640  Propanoate metabolism
lmz00680  Methane metabolism
lmz01100  Metabolic pathways
lmz01110  Biosynthesis of secondary metabolites
lmz01120  Microbial metabolism in diverse environments
lmz01130  Biosynthesis of antibiotics
lmz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2482_2742 (acsA)
   00620 Pyruvate metabolism
    LMOSLCC2482_2742 (acsA)
   00640 Propanoate metabolism
    LMOSLCC2482_2742 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2482_2742 (acsA)
Enzymes [BR:lmz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMOSLCC2482_2742 (acsA)
Lipid biosynthesis proteins [BR:lmz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMOSLCC2482_2742 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBY05263
Position
2792259..2793836
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDAEGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccaccatgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgatcattggctcgatattcacgaagacgatatcgtttgggccacagctggtcct
ggttggcaaaaatgggtttggtctcctttcctttctgtactcggaaaaggtgccactggc
ttcatttacaacggtcgtttcattcctgaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctgtgctgtacgccaacagaatatcgcttaatggctaaagtaaataatttg
cgcgaacatgatttaagttctcttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccaagataattttgatattaaagttcgcgacggctacggtcaa
acggagagtacactgttgattgggacactggttgatacgccgattcgccctggttcgatg
ggtaaaccgattatgcctgaatacatggcgattattgatgctgaaggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
attagctctggttacacgattggaccgttcgaagtagaggacgcgctcacacatcatcca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggtacggtcgtaaaa
gcatttatcgtcttaaaggatggttacgagggcacggaagatcttgtgcatgaattacaa
acattcacgaaagaacaaaccgctccgtataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgccgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system