KEGG   Loa loa (eye worm): LOAG_00088Help
Entry
LOAG_00088        CDS       T02664                                 

Definition
josephin-2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     LOAG_00088
Peptidases [BR:loa01002]
 Cysteine Peptidases
  Family C86
   LOAG_00088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 185 aa AA seqDB search
MSIDESSGSVVPTGQLYHEKQQMQLCLMHTLNTLLQRNEFKKVDLDCIAENLHRSRWFNR
HRSMFGFGNYDINVLIAALETRNLLLNWFDSRRSTACLDFSKIFGFIFNITSRGFIPFWT
GHHWFTVRQIGVAGFFNFDSKLDEPVPINDFVAFSDSLLAKGAQLMVVVEPQNANSYLLN
NKCLV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgatgaatcgtctggaagtgtagtccccacaggacaattatatcacgagaaa
caacaaatgcagctctgtttgatgcatacgctgaatactttgttgcagagaaatgaattt
aaaaaggttgatttggattgtatcgcggagaatttacatagatcgcgctggttcaatcga
caccgttcaatgtttggttttggcaattacgatattaacgtgctgatcgcggcattggaa
acaagaaatctactgttaaactggtttgattcgaggcgttccactgcctgtttggatttt
tcgaagattttcggtttcatattcaatatcacatcacgtggctttataccgttctggaca
ggacatcactggttcactgtgcggcaaataggtgtggccggatttttcaatttcgattca
aaattggacgaaccagtgccaattaatgactttgttgcattttcggattcactattagca
aagggagctcaattgatggttgttgttgaacctcaaaatgctaacagttatttattgaat
aataagtgtttggtttga

DBGET integrated database retrieval system