KEGG   Loa loa (eye worm): LOAG_00232Help
Entry
LOAG_00232        CDS       T02664                                 

Definition
protein disulfide isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
loa  Loa loa (eye worm)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:loa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOAG_00232
Enzymes [BR:loa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     LOAG_00232
Exosome [BR:loa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LOAG_00232
  Exosomal proteins of colorectal cancer cells
   LOAG_00232
  Exosomal proteins of bladder cancer cells
   LOAG_00232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 519 aa AA seqDB search
MGEQHTTLCAPGMRRGGERLVVVLSLSLQFVLHPVAQDASVEEDEGVLILTKDNFDDTVA
AHEFILVEFYAPWCGHCKALAPEYAKAAQLLKKEESPIKLAKCDATAHSELASKYEVRGY
PTLKLFRSGKPQEYGGGRDAESIIAWLKKKTGPAAKTILSADDVKDFQENNEVCIIGYFK
DTESANAKVFLEVAAGFDDIPFGITTENDAAKQIELKSEGVVLLKKFDEGRAEFSEKLIA
ETLKTWIQAQRLPLVSEFTQDTAPVIFGGDIKSHNLLFVSKEGSEFGKLEKEFRAAAKKF
KGKVLFVIINTDVEDNARILEFFGLKKEDLAALRLISLEEDMTKYKPEFKEITAENIVQF
TEMYLAGKLKPHLMTQDIPGDWDKNPVKVLVGKNFDDVAKDAKKNVIVLFYAPWCGHCKQ
LMPTWDKLGEKYKDHDSILIAKMDATANEVEDVKVQSFPTIKFFPASSNKIIDFTGERTL
EGLTKFLESGGKDGAGLSDQEKAEAEAENEDEEAQHTEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaacaacacacaacgctctgtgcgccaggaatgcggagaggaggggaaaggttg
gttgtcgttcttagcctgtcgcttcaatttgtactacaccccgtggctcaagatgcaagc
gtagaggaggatgaaggagtcctcatacttacaaaggataattttgatgacacggtagca
gcacatgagtttatcctggttgaattctatgcaccatggtgtggacactgtaaggctttg
gcacctgaatatgcaaaagcagcgcagttgctgaagaaagaggagagccccatcaagctt
gcaaagtgtgacgccacggcacacagcgagcttgcttcaaaatatgaggtgcgtggttat
ccgacgctgaagttattccgttcgggtaaaccgcaggaatatggtggtggacgagatgca
gagtccatcattgcttggctaaaaaagaagacaggtccagcagccaaaactatactttca
gctgatgatgtgaaggacttccaggaaaacaacgaagtgtgcatcattggttattttaag
gatactgaaagcgcgaatgcaaaggttttcctggaagtagctgcagggtttgatgatata
ccattcggtatcactactgaaaatgatgcggcaaagcagattgaactgaaaagtgagggc
gttgtgttgttgaaaaaattcgacgaaggacgggccgaatttagtgagaaattaatagct
gaaacacttaaaacttggattcaggctcaaagattaccgcttgtgagtgaattcacgcaa
gatactgcaccagttattttcggtggtgacattaaatcacacaacctcttattcgtttca
aaagaaggctcagaattcggaaaactggagaaagagttccgagcagctgccaagaaattc
aagggcaaggttcttttcgtcataattaatacagacgtagaggacaatgctcgtatcctg
gaattcttcggtctgaaaaaggaagatttagcagcactgagattgatcagtctggaagaa
gatatgactaaatacaaacccgaattcaaagaaattacagcggaaaatattgtacagttc
acggaaatgtatcttgctggtaaactaaaaccacatctgatgactcaggatattcctggt
gactgggataagaatccagtaaaggtactagttggaaagaactttgacgatgtcgcaaag
gatgctaaaaagaacgtcattgtgttgttctatgctccatggtgtggacattgcaaacag
ctgatgccgacatgggataaattaggtgaaaaatataaggatcatgacagtatactgatc
gctaaaatggatgcgacagcaaatgaagtggaagatgttaaagtgcagtcattcccaaca
attaaatttttccctgctagttctaataagattattgactttactggtgaaaggacattg
gaagggctgacgaaatttctggaaagcggaggtaaagatggtgctggtttatcagaccaa
gagaaggcagaggctgaagcagaaaatgaagatgaagaagcacaacatactgaactgtaa

DBGET integrated database retrieval system