KEGG   Loa loa (eye worm): LOAG_00547Help
Entry
LOAG_00547        CDS       T02664                                 

Definition
(RefSeq) variant SH3 domain-containing protein
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
loa  Loa loa (eye worm)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    LOAG_00547
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    LOAG_00547
   04020 Calcium signaling pathway
    LOAG_00547
   04070 Phosphatidylinositol signaling system
    LOAG_00547
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    LOAG_00547
Enzymes [BR:loa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     LOAG_00547
Membrane trafficking [BR:loa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    LOAG_00547
 Endocytosis
  Macropinocytosis
   Phospholipase C
    LOAG_00547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 1310 aa AA seqDB search
MHPQSSTDSVLLSQRSVLFSPLSTTSSLITSRSVEFAMEKVFHAMEMGHNVYKLLLMKRR
DPAQKRLTYNRETRQLFLSKLDNSDKVKIHAKDFLCASWSSSKTLRLDLRVVKEVHTLDY
KLRKIKIGDKWEKDKEFKQFDAARILVLSYATSFNLRYWILLFDTEELCRMWCQGVHHLM
LDTISACHALLVERWLRKEFYNIAGYGLENPCVAMKHMKPFVHTSLQYKVQSKQLQEDIM
YYDTFAIAYRKLLHSNSLFAEHFAAYSDDAAVVSFNNFLRFHKDKQNDEIGMMRERASDF
LRHFLREWDPYRDVPEPTLSVTEFCDFLFSRENSLWDSVNENVIHDMNRPLSHYWIASSH
NTYLTGDQLKSESSLDTYARALLMGCRCVELDCWDGQKRSSGEIQDIVIYHGYTMTSKIN
LRDVLYTIRHYAFINSEFPVILSIEDNCSVPVQRLLAREIREILGNYLLTAPVSREETCL
PSPAALKRKIILKHKKLPTESENIASQQTDEDQEQDLLSLNFTRQGILSLKSGVNDEWTT
HLFVLFPDRLCYMLEQCESNFNNQGILRRQDSLGNAQDDENQDGLTNLTGFVVPQEEMHV
TEEWFHGKTDRDTARMRLLEHKDKGNGLFLVRDSTIFIGDYSLSFLHNEKVHHCRIRTRM
VNGERKYYFLENKQMDTLYELISHYTKERLRTPNFSTTLVTPCPQPCPHLGMIWFCEKTD
RNRAEELLNTVQQDGAFLLRFSSTDKNVFVLSLRVDGEIWHYHLKRDGRIFVVNQTLFEN
LNQIVEFYSTREFVHGICLKYPVGENTITDSTGAWFSADRAPGCYMELKDIDKEILVRAI
EPYNGSLPSELSFPINAVIRVFRKDGDRWRGKYGIHSGFFPSRCVIELENSDNMSNELSV
YAAIDLADSLIEEVPFEVAGRPFAFKIRRVSAHWNPSEYVLAANSNEDREDWLNILHELT
RTATDRNTLIRTREKNLRIASELSDLVVYCQAVPFNSQFATQGNFYEMCSFSETKFEKLM
ERGLVQFNSRQLSRVYPQGSRVTSANYDPVPMWNAACHMVALNYQTGDRSMQLNQGKFMA
NGQCGYVLKPSYMIDEMFSPDAAEVVSTSCPIILTVHVIAGQHLSRKDRNRGICSPVVTV
EIVGLPADSSTIRTRAIASNGLNPVWNEKFSFKVYCPEIALLRLYVEDGDFMGPKMDPFI
GQAVYPLDCIRTGFRSVPLRNQYGEELELSSLLVYLDMRDQSNEAEVLNPHVALQAGRCF
AGGLHKTLSSSGIFWARLNSADQSDFKPPLSPNISAAKHIPVPMDLTSLE
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctcaaagctcaacagattcggtattattatctcagcgttcagtattattctct
cccctatctacaactagttcgcttataacatcacgctcagtggaatttgcaatggaaaaa
gtgtttcatgcaatggaaatgggtcataacgtttacaaacttctgttgatgaaacgacgg
gatccagcacaaaaaaggttgacttataaccgtgagacaaggcagctgtttttgtcaaag
ctagataattctgacaaggttaaaattcatgctaaagattttttgtgtgcttcatggagt
agcagtaaaactctgcgattagatttacgagtagtgaaggaagtgcatacacttgattat
aaactaagaaagatcaaaatcggcgacaagtgggaaaaggacaaagaattcaaacagttt
gatgcagctagaatattagttctaagttatgcgacgagtttcaatttgcggtattggatt
ttgttattcgatacggaagagttatgtcgaatgtggtgtcagggtgttcaccacttgatg
ctggatacaatttctgcttgtcatgcacttctcgtggaacgatggctcaggaaagagttc
tataatattgctggttatggtctcgaaaacccttgcgtagcgatgaaacacatgaagcct
ttcgtgcatactagtttgcagtataaggtacaatcaaaacaattgcaagaagacataatg
tattatgatactttcgcaattgcttatcgcaaacttttgcattctaattctcttttcgca
gaacattttgcagcttactcggatgatgcggctgttgtcagcttcaacaatttcctgcgg
tttcacaaggataaacaaaatgatgaaatagggatgatgcgcgaaagagccagtgatttt
cttaggcatttcttaagggaatgggatccatatagagatgttcctgaaccaacccttagc
gtgactgaattttgcgacttcctcttctctcgcgaaaattcactatgggattctgttaac
gagaatgttatacatgacatgaatcgaccactaagtcactactggattgcttcatcacac
aacacatatcttaccggtgatcaactcaagagtgaatcctcgttggatacgtatgctcga
gctttgcttatgggctgtagatgtgttgaactcgactgctgggatggacaaaagagaagt
tcaggtgaaatacaagatattgttatttaccatggttacacaatgactagtaaaatcaat
ttgcgcgatgtgctttacaccattcgtcattacgcttttattaacagcgagtttccagtg
attctctcgattgaagacaattgttcagtaccggtacaacggttgcttgctcgtgaaatt
agagaaattcttggtaattatttactcacagctccagttagtcgtgaagaaacttgttta
ccatctccggcagctctgaagcgaaaaattatcttgaagcataagaaactgccgacggaa
agtgaaaatattgcttcacagcaaactgatgaggatcaagaacaggatttactttcactg
aattttactcggcaaggaattctgtcattgaaaagtggtgtaaacgatgaatggacaact
cacttatttgtattgtttccggatcgtttgtgttatatgctggaacagtgcgaaagtaat
ttcaataatcaggggattctgagacgtcaagattcactggggaacgcacaggatgatgaa
aatcaggatggtttgacaaacttgacaggtttcgttgtacctcaagaagaaatgcatgtt
acagaagaatggtttcatggcaaaacagatcgagatacagcaagaatgcgtcttttggaa
cacaaagataaaggcaatggtctttttttggttcgcgattcaactattttcattggcgac
tactccttatcgtttctgcataatgagaaagtacatcactgtcgaatacgcaccaggatg
gtgaatggtgaaagaaaatattattttttggaaaataagcaaatggatacactttatgag
cttatatcgcactatacgaaggaaagattgaggacaccgaattttagcacaacactggtc
actccatgtccgcagccttgtcctcatctcggaatgatatggttttgtgagaaaacagat
agaaatcgtgccgaagaacttctgaacacggttcaacaagatggggctttcttgctgcgc
ttcagttctactgataaaaatgttttcgtgctttctctaagagttgacggcgaaatatgg
cattaccatttgaaacgtgatggtcgaatttttgttgtcaaccagacacttttcgagaat
ttgaatcaaatagttgaattttattcaacaagagaattcgttcatggaatatgtctgaaa
tatcccgtgggtgagaatactattactgattctacaggtgcatggtttagtgcagatcga
gcacctggttgttatatggaactcaaggacattgataaagagatattggttcgggctatt
gagccgtacaatggatctcttcccagcgagctttcattccctataaatgcagtgataaga
gtattcagaaaagacggtgatcgctggcgtggcaaatatggcattcattcaggtttcttt
ccttctcgatgcgttattgaactggaaaattctgataatatgtcgaatgaattgagcgtt
tatgcagcaatcgatttggctgattctttgattgaagaagtaccgtttgaagttgctggt
cgaccgtttgcatttaaaattagacgtgtttcagcgcactggaatccaagcgaatatgtt
ttggcagctaattcaaatgaagatcgtgaagactggttaaatattctgcacgagctgact
agaacagctacggatcgcaataccttgatacgtacacgagaaaagaatttgcgaatagct
tctgaattgtctgatttggtggtttactgccaggctgtccctttcaattcacaattcgca
acacaaggcaatttctatgagatgtgctcgttcagtgaaacaaaattcgagaaactgatg
gaacgaggtttagttcagtttaattctcgtcagttgtcacgtgtttatccgcaaggttca
cgtgttacttctgcaaattatgatccggtaccgatgtggaatgccgcatgccatatggtt
gcactgaattaccaaactggcgataggtcgatgcagctaaatcagggtaaatttatggca
aatggtcagtgtggatatgtgctgaaaccatcttatatgatcgatgaaatgttttctcca
gatgctgccgaagtagtgtctacctcttgtccaatcattcttactgttcatgtaatagca
ggacagcatttgtcaaggaaagatagaaatcgaggtatctgttctccagttgttactgta
gaaattgtcggtttgccggctgattcatccactattcgaacacgagctattgcttccaat
ggcctgaatcctgtttggaatgagaaattcagcttcaaagtttactgtccagaaatagct
ttacttcgcttatatgttgaagatggtgattttatgggacccaaaatggatccatttatt
ggacaggctgtgtatccacttgactgcattcgcactggttttcgatctgtgccacttcgt
aatcagtatggcgaagaattggaattgtcatcgttactcgtttatctcgatatgcgcgat
caaagtaatgaagcagaagttctaaatccacacgttgctttgcaggctggccgatgtttt
gccggtggattgcataaaacgttatcatcatctggtatattttgggcacgattgaattca
gccgatcagagtgatttcaaaccaccactgtcacccaatatatcagctgcaaaacacatt
ccagttccgatggatttaacatccttagagtaa

DBGET integrated database retrieval system