KEGG   Loa loa (eye worm): LOAG_00956Help
Entry
LOAG_00956        CDS       T02664                                 

Definition
FAD binding domain-containing protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
loa  Loa loa (eye worm)
Brite
Enzymes [BR:loa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     LOAG_00956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 651 aa AA seqDB search
MTVAVMDWLRTRLDIIDLIVLTIVLLTTVYYSWRSWIGKTTNKFTPTVLPSYTSPSNSFD
RQTSFVARMKSEERKVLIIYGSQTGTAEELAGRLSKDVQNYGQKALLLDPEEMNVEDFEK
IKEIPGVLLILFMATYGEGDPTDNAQEFYQHVLNTDLNLTGVNFAVFGLGNKTYGHFNEI
AKYFNRRMEEFGATRIYSLGLGDDDRNLEEDFMRWREGFWSAITNIFGWEIAETGSLRQY
RLEIVEDFSVKLFTGEYGRLGSFEKQRPPFNQKNPFIATVNINRELHDMKSDRSCRHIEF
IISEARMRYEVGDHLGVFPTNDPVFVEELGQLLDADMDLRFSLVNLDEENLKKNPFPCPC
TVRTAFTHYVDICAPVKSNVLKALASFTSAEDEKERLLLLSTANEQGLKEYGNYIQKERR
SIIDILRAFPTCKPPVDYVLELLPRLQPRYYSISSSSKYDRELLAITVVVTRYMIGNRLV
KGGEGSKVPIFVRKSTMRLPHRLETPVIMIGPGTGFAPFRGFLQERSFQKKQGQGIGPMI
LYYGCRHPEQDYIYEEELKKFIEDGVLSELHTAFSRIYVQDEIWKSREAIWRAVEDGANI
FICGDARNMARDVQNTFIRIFMEVGGKTEIEAQKFQKDLERKRCYQTDVWS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggcagtgatggattggttgcgaacacggctggacataattgatttgattgtt
ttaaccatcgtactgcttacaacagtctattattcctggaggtcatggatcggaaaaacc
actaataagttcacaccaactgtcttgccatcctacacttctcccagcaattcatttgat
cgacaaacttcattcgttgcacgtatgaaatcggaagaacgaaaggtcttaataatttat
ggctcacaaacgggaacagctgaggaattggctggtcgtctttctaaggatgttcagaat
tacggtcagaaggctcttttactcgacccagaggaaatgaatgttgaggatttcgaaaaa
attaaagaaattcctggtgttcttctgatattattcatggcaacttacggggaaggcgat
ccgacagataatgcgcaggaattttatcagcatgttttgaatacggacctcaatttgaca
ggcgttaatttcgccgtttttggcttaggtaataaaacatatgggcacttcaatgaaatt
gcgaaatatttcaaccgacgaatggaagaattcggtgctacgcgtatttacagccttggc
ctcggcgatgatgatcgaaatctggaggaggattttatgaggtggcgagaaggcttttgg
tctgctataacaaatatttttggttgggaaattgctgaaacaggttcattacgacagtat
cgccttgaaattgtggaagatttctcggttaaattattcacgggggagtacggccgacta
ggatcatttgaaaaacaaagaccgcccttcaatcagaagaatccatttatcgctactgtt
aatattaatcgtgagctacacgatatgaaaagtgatagaagttgtcgtcacatcgaattt
atcatcagtgaagcaagaatgaggtatgaggtgggtgatcatttaggcgttttcccaaca
aatgatccagtcttcgtggaagaattggggcaattgcttgacgctgatatggatctacgt
ttcagtctggttaatcttgatgaggaaaacctgaaaaagaatccatttccgtgtccatgt
acagtaagaaccgcttttactcattacgtagatatctgtgcaccagttaaatccaatgtt
ctgaaagcattagcttccttcacaagtgctgaagatgagaaagaacgtcttttattgttg
agcacggcaaatgaacagggtttgaaggaatacgggaattatattcagaaagaaaggcgt
tctattattgatattcttcgtgcattcccgacatgtaaacctccagttgattatgttcta
gaattgttgcctcgtcttcagcctcgttattacagcatatcatcatcatccaaatatgat
cgtgaattactggctataacagttgttgtaacaagatatatgattggcaatcgattagtc
aaaggaggtgaaggttctaaagtaccaatatttgttagaaaatcaacaatgcgattacca
catcgactggaaacaccagttattatgataggtcctgggacaggctttgctccatttaga
ggttttctccaggagcgaagtttccagaagaaacaaggccaaggcattgggccgatgata
ttatattacggctgtcgacatccagaacaagattacatttatgaagaagaactgaagaaa
ttcattgaagatggtgtactttccgaactacacactgcattttccagaatttatgtgcaa
gatgaaatttggaaaagtcgcgaagcaatatggagagctgttgaagatggtgcaaatatt
tttatttgtggcgatgcgcgtaatatggcacgtgatgtgcaaaatacattcatacgaata
ttcatggaggttggagggaaaaccgaaattgaagcacagaaattccaaaaggatttggaa
cggaaacgatgttaccaaacagatgtctggtcttaa

DBGET integrated database retrieval system