KEGG   Loa loa (eye worm): LOAG_01176Help
Entry
LOAG_01176        CDS       T02664                                 

Definition
hypothetical protein
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
loa  Loa loa (eye worm)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 314 aa AA seqDB search
MTLTNMSLIIRLFTMLLIASSLLLIVASEGNYVVTINDQKDYKKLLRVHKNVLILFFNSS
MDKNIQLKKVVKTTMEAAKQAMGQGTVAQINCNDGEVKKLCKKLKITPKPYILKHYQNGE
FHKDYDRRINTNSMYRFLLDPAGDIPWDEDPTAVNVVHLDDSNALRKTVGGGKPVLIMFY
APWCSFCKRLKPEFSAAADVLKGKVVLAGMDLTHRGNEVIAKQFNIDGYPTLEYFEGGMH
KFRYSGQNSKDGIIEWLKNPVEQASSLSLEEEEISWTDAITEVVLLNDDTFDEFIAEHRS
VLVLIYAPCMLIST
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacactgaccaatatgagtttgattattcgcctgtttacaatgttgttgattgcctca
tcgttgttgttaattgttgcgtccgaagggaattatgttgtaacaattaatgaccaaaaa
gactacaagaaattattacgagtgcataaaaatgtgctgatactgttttttaattcttct
atggataaaaacatccaactgaaaaaagtggtaaaaaccaccatggaagctgctaaacag
gcaatgggacaaggaactgttgctcaaatcaactgtaacgatggtgaagtaaagaagtta
tgtaaaaagcttaaaataaccccaaaaccatacatcctgaaacattaccagaacggagaa
tttcacaaagactatgataggagaataaatacaaatagcatgtatcgtttcttgttagat
ccagccggtgatataccatgggatgaagacccgacagctgttaatgtcgttcatctagat
gactctaatgcgcttcgaaaaacagttggtggtggaaaacctgtactgatcatgttttat
gctccttggtgtagcttctgtaaacgtttgaaacctgaatttagtgctgcagcagatgta
ttgaaagggaaggtcgtactggcaggcatggatttaacacatcgtggtaacgaagttatt
gcaaaacagtttaacattgatggttatccaacacttgagtattttgagggtggcatgcat
aaatttagatacagtggacaaaattcaaaggatggcataattgaatggcttaaaaatcca
gtggaacaagcgtcatctctctctcttgaagaggaagaaatttcatggactgatgccatc
accgaagtggttcttttaaatgatgacacatttgatgaatttattgcggaacatcgaagc
gttctggtccttatctatgctccttgtatgcttatttccacttga

DBGET integrated database retrieval system