KEGG   Loa loa (eye worm): LOAG_01433Help
Entry
LOAG_01433        CDS       T02664                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
loa  Loa loa (eye worm)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LOAG_01433
   00330 Arginine and proline metabolism
    LOAG_01433
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LOAG_01433
Enzymes [BR:loa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LOAG_01433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 701 aa AA seqDB search
MYSGTSINALRAKYRLTEDQHRKNFEAMESDEYKCASAAVDNVSKILKNNRKSSITRLLN
DTAKGLKHVYQLSHPSQEDLTYDLFKCSKKPGEASLGKLLSVLRSFGIREDDPRLKHTIE
KMREYELQIEDDCDTRHCLLSKEQFKECIRPSINLIAQTLRNDLIIPCWGEFTAKIKEIF
DECASIHDGRVADYIPQLARVDPKKWGLSICTIDGQRVSYGDARVPFCFQSISKAFNYAI
VASDLGADFVHNYVGHEPSGRLFNEICLDCNGKPHNPFINAGAIIVTSLLKMGHEMADRY
DFVLTQYRKLAGGGYIGFNNATFLSERDTADRNYALSYYMKENNCFPGSVSLRDELDFYF
QLCSLETTCESAAVMAATLANGGVCPLTNEICISARPCRDVLSLMYSCGMYDYSGQFAFQ
VGLPAKSGVSGAMVVVVPNLMGICIWSPPLDKMSNSVRGVSFCKKMIETFNFHNYDSLLH
ADTKKIDPRKRGIPNESELILEMMFATKKGNIDDVRRMFLGGIDLNMSDYDGRTPLHLAA
SEGQSLMVDFFLDIAHVNPLVRDRWNRTAYDDALSFGYTKIAEKIKSSMDKISGGFVPIT
IPPEKALQLLPENGDVLINLPEEENEWEKELRIVVDRLSHFDHSNVDDDYLTSPRIAENG
DGTSDILQKSSERNGSFSALNAESMVDGSDGQINLGMKFSG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcggaacatcgatcaatgcgctacgagctaagtatcggttaaccgaagatcaa
catcgtaaaaattttgaagcaatggagagcgacgagtacaagtgcgcctctgctgcagtt
gataatgtaagcaagatcttgaaaaacaaccggaaatcatcgattactcgactgctgaat
gataccgctaagggtttgaaacatgtttatcagctttcacacccatcgcaggaagatctc
acgtacgatctcttcaaatgttccaaaaaacccggagaagcttctttggggaaactactt
tctgtattgcgatcatttggcatccgtgaagacgatccacgattgaaacatacgattgaa
aaaatgcgtgaatatgaactgcagatcgaggatgactgtgataccagacactgcttgtta
agcaaggaacagttcaaagaatgtattcgaccaagcatcaatttaattgcccagacactt
cgcaacgatttgattattccttgttggggcgaatttactgctaagatcaaggaaattttt
gatgaatgcgcgagtattcatgatggcagagtagcagattatatccctcagttagctaga
gtggatccgaagaaatggggtctttcgatatgtacaattgatggacaacgtgtcagttac
ggtgatgcacgtgtaccgttttgttttcagtctatatcaaaggctttcaattatgcaata
gtcgcgtctgatttgggagcagattttgtccacaattatgtcgggcatgaaccatccggg
cgattattcaatgaaatatgtctggattgcaatggtaaaccacataatcctttcataaat
gctggagcaattattgtcacgtcactactgaaaatgggacatgaaatggctgatcgttat
gattttgtactaacccaatacagaaaactagcaggaggtggttacataggatttaataat
gcaaccttcttatctgaacgcgataccgcagatcgtaattatgcgctttcttactacatg
aaagaaaataattgctttcctggttcagtatcgctccgggatgagcttgatttctatttc
cagttgtgttcattggaaacaacatgtgaaagtgctgcggtaatggcagcaactttggct
aatggaggtgtttgtccacttaccaacgaaatatgcattagtgctcggccatgtcgcgat
gttctttcattgatgtattcatgtgggatgtacgattacagcggtcagttcgcatttcag
gttggcttacctgcaaaatctggtgtctctggagcaatggttgttgtggtaccaaatttg
atggggatttgtatttggtcgccgcctttggataaaatgagtaatagtgtacgtggtgta
agcttctgtaagaaaatgatcgaaactttcaattttcacaattacgacagtttattgcat
gcggataccaagaaaatagatcctcgaaagcgtggcattccaaatgaatccgaattaatc
cttgaaatgatgtttgcaactaagaaaggcaacattgatgatgttcgaagaatgtttttg
ggtggcattgacttgaatatgtcagactatgatggtcgcacaccactacatctagctgct
tcagaaggacaatcgttaatggtggatttctttctcgacattgctcatgttaatccactt
gtgagagatagatggaataggaccgcttatgatgatgctttgtcgtttggatataccaaa
attgcggaaaaaattaaatcatctatggataaaatatctggtggattcgtgccaataaca
attcctccggaaaaagcacttcagttgctacccgagaacggtgatgttttaattaatttg
ccagaagaggaaaatgaatgggaaaaagaattgcgaattgtggttgatcgtttatctcat
ttcgaccattcaaatgttgatgatgattatttgaccagtcccagaattgctgagaacggc
gatggaacgtctgatattttgcaaaagtcgtctgaaaggaatggtagctttagtgctctg
aatgctgaaagtatggtggacgggagtgacggtcagatcaaccttggcatgaaattttca
ggttga

DBGET integrated database retrieval system