KEGG   Loa loa (eye worm): LOAG_01433Help
Entry
LOAG_01433        CDS       T02664                                 

Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
loa  Loa loa (eye worm)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:loa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LOAG_01433
   00220 Arginine biosynthesis
    LOAG_01433
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LOAG_01433
Enzymes [BR:loa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LOAG_01433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
AA seq 674 aa AA seqDB search
MESDEYKCASAAVDNVSKILKNNRKSSITRLLNDTAKGLKHVYQLSHPSQEDLTYDLFKC
SKKPGEASLGKLLSVLRSFGIREDDPRLKHTIEKMREYELQIEDDCDTRHCLLSKEQFKE
CIRPSINLIAQTLRNDLIIPCWGEFTAKIKEIFDECASIHDGRVADYIPQLARVDPKKWG
LSICTIDGQRVSYGDARVPFCFQSISKAFNYAIVASDLGADFVHNYVGHEPSGRLFNEIC
LDCNGKPHNPFINAGAIIVTSLLKMGHEMADRYDFVLTQYRKLAGGGYIGFNNATFLSER
DTADRNYALSYYMKENNCFPGSVSLRDELDFYFQLCSLETTCESAAVMAATLANGGVCPL
TNEICISARPCRDVLSLMYSCGMYDYSGQFAFQVGLPAKSGVSGAMVVVVPNLMGICIWS
PPLDKMSNSVRGVSFCKKMIETFNFHNYDSLLHADTKKIDPRKRGIPNESELILEMMFAT
KKGNIDDVRRMFLGGIDLNMSDYDGRTPLHLAASEGQSLMVDFFLDIAHVNPLVRDRWNR
TAYDDALSFGYTKIAEKIKSSMDKISGGFVPITIPPEKALQLLPENGDVLINLPEEENEW
EKELRIVVDRLSHFDHSNVDDDYLTSPRIAENGDGTSDILQKSSERNGSFSALNAESMVD
GSDGQINLGMKFSG
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgacgagtacaagtgcgcctctgctgcagttgataatgtaagcaagatcttg
aaaaacaaccggaaatcatcgattactcgactgctgaatgataccgctaagggtttgaaa
catgtttatcagctttcacacccatcgcaggaagatctcacgtacgatctcttcaaatgt
tccaaaaaacccggagaagcttctttggggaaactactttctgtattgcgatcatttggc
atccgtgaagacgatccacgattgaaacatacgattgaaaaaatgcgtgaatatgaactg
cagatcgaggatgactgtgataccagacactgcttgttaagcaaggaacagttcaaagaa
tgtattcgaccaagcatcaatttaattgcccagacacttcgcaacgatttgattattcct
tgttggggcgaatttactgctaagatcaaggaaatttttgatgaatgcgcgagtattcat
gatggcagagtagcagattatatccctcagttagctagagtggatccgaagaaatggggt
ctttcgatatgtacaattgatggacaacgtgtcagttacggtgatgcacgtgtaccgttt
tgttttcagtctatatcaaaggctttcaattatgcaatagtcgcgtctgatttgggagca
gattttgtccacaattatgtcgggcatgaaccatccgggcgattattcaatgaaatatgt
ctggattgcaatggtaaaccacataatcctttcataaatgctggagcaattattgtcacg
tcactactgaaaatgggacatgaaatggctgatcgttatgattttgtactaacccaatac
agaaaactagcaggaggtggttacataggatttaataatgcaaccttcttatctgaacgc
gataccgcagatcgtaattatgcgctttcttactacatgaaagaaaataattgctttcct
ggttcagtatcgctccgggatgagcttgatttctatttccagttgtgttcattggaaaca
acatgtgaaagtgctgcggtaatggcagcaactttggctaatggaggtgtttgtccactt
accaacgaaatatgcattagtgctcggccatgtcgcgatgttctttcattgatgtattca
tgtgggatgtacgattacagcggtcagttcgcatttcaggttggcttacctgcaaaatct
ggtgtctctggagcaatggttgttgtggtaccaaatttgatggggatttgtatttggtcg
ccgcctttggataaaatgagtaatagtgtacgtggtgtaagcttctgtaagaaaatgatc
gaaactttcaattttcacaattacgacagtttattgcatgcggataccaagaaaatagat
cctcgaaagcgtggcattccaaatgaatccgaattaatccttgaaatgatgtttgcaact
aagaaaggcaacattgatgatgttcgaagaatgtttttgggtggcattgacttgaatatg
tcagactatgatggtcgcacaccactacatctagctgcttcagaaggacaatcgttaatg
gtggatttctttctcgacattgctcatgttaatccacttgtgagagatagatggaatagg
accgcttatgatgatgctttgtcgtttggatataccaaaattgcggaaaaaattaaatca
tctatggataaaatatctggtggattcgtgccaataacaattcctccggaaaaagcactt
cagttgctacccgagaacggtgatgttttaattaatttgccagaagaggaaaatgaatgg
gaaaaagaattgcgaattgtggttgatcgtttatctcatttcgaccattcaaatgttgat
gatgattatttgaccagtcccagaattgctgagaacggcgatggaacgtctgatattttg
caaaagtcgtctgaaaggaatggtagctttagtgctctgaatgctgaaagtatggtggac
gggagtgacggtcagatcaaccttggcatgaaattttcaggttga

DBGET integrated database retrieval system